KEGG   Homo sapiens (human): 3605Help
Entry
3605              CDS       T01001                                 

Gene name
IL17A, CTLA-8, CTLA8, IL-17, IL-17A, IL17
Definition
(RefSeq) interleukin 17A
  KO
K05489  interleukin 17A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04657  IL-17 signaling pathway
hsa04659  Th17 cell differentiation
hsa05321  Inflammatory bowel disease (IBD)
hsa05323  Rheumatoid arthritis
Drug target
Afasevikumab: D10902
Ixekizumab: D10071
Secukinumab: D09967
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3605 (IL17A)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    3605 (IL17A)
   04657 IL-17 signaling pathway
    3605 (IL17A)
 09160 Human Diseases
  09162 Immune diseases
   05323 Rheumatoid arthritis
    3605 (IL17A)
   05321 Inflammatiory bowel disease (IBD)
    3605 (IL17A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3605 (IL17A)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3605 (IL17A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL17
Motif
Other DBs
NCBI-GeneID: 3605
NCBI-ProteinID: NP_002181
OMIM: 603149
HGNC: 5981
Ensembl: ENSG00000112115
Vega: OTTHUMG00000014840
Pharos: Q16552(Tclin)
UniProt: Q16552
Structure
PDB: 

Position
6p12.2
AA seq 155 aa AA seqDB search
MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNP
KRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEIL
VLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgactcctgggaagacctcattggtgtcactgctactgctgctgagcctggaggccata
gtgaaggcaggaatcacaatcccacgaaatccaggatgcccaaattctgaggacaagaac
ttcccccggactgtgatggtcaacctgaacatccataaccggaataccaataccaatccc
aaaaggtcctcagattactacaaccgatccacctcaccttggaatctccaccgcaatgag
gaccctgagagatatccctctgtgatctgggaggcaaagtgccgccacttgggctgcatc
aacgctgatgggaacgtggactaccacatgaactctgtccccatccagcaagagatcctg
gtcctgcgcagggagcctccacactgccccaactccttccggctggagaagatactggtg
tccgtgggctgcacctgtgtcaccccgattgtccaccatgtggcctaa

DBGET integrated database retrieval system