KEGG   Homo sapiens (human): 3606Help
Entry
3606              CDS       T01001                                 

Gene name
IL18, IGIF, IL-18, IL-1g, IL1F4
Definition
(RefSeq) interleukin 18
  KO
K05482  interleukin 18
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa05132  Salmonella infection
hsa05134  Legionellosis
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05321  Inflammatory bowel disease (IBD)
hsa05323  Rheumatoid arthritis
Disease
H01360  Allergic rhinitis
H01516  Adult onset Still's disease
Drug target
Iboctadekin: D04487
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3606 (IL18)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    3606 (IL18)
   04623 Cytosolic DNA-sensing pathway
    3606 (IL18)
 09160 Human Diseases
  09162 Immune diseases
   05323 Rheumatoid arthritis
    3606 (IL18)
   05321 Inflammatiory bowel disease (IBD)
    3606 (IL18)
  09167 Infectious diseases
   05132 Salmonella infection
    3606 (IL18)
   05134 Legionellosis
    3606 (IL18)
   05152 Tuberculosis
    3606 (IL18)
   05164 Influenza A
    3606 (IL18)
   05144 Malaria
    3606 (IL18)
   05143 African trypanosomiasis
    3606 (IL18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3606 (IL18)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3606 (IL18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1
Motif
Other DBs
NCBI-GeneID: 3606
NCBI-ProteinID: NP_001553
OMIM: 600953
HGNC: 5986
Ensembl: ENSG00000150782
Vega: OTTHUMG00000167006
Pharos: Q14116(Tbio)
UniProt: Q14116
Structure
PDB: 

Position
11q23.1
AA seq 193 aa AA seqDB search
MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQ
GNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFK
EMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDEL
GDRSIMFTVQNED
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgaaccagtagaagacaattgcatcaactttgtggcaatgaaatttattgac
aatacgctttactttatagctgaagatgatgaaaacctggaatcagattactttggcaag
cttgaatctaaattatcagtcataagaaatttgaatgaccaagttctcttcattgaccaa
ggaaatcggcctctatttgaagatatgactgattctgactgtagagataatgcaccccgg
accatatttattataagtatgtataaagatagccagcctagaggtatggctgtaactatc
tctgtgaagtgtgagaaaatttcaactctctcctgtgagaacaaaattatttcctttaag
gaaatgaatcctcctgataacatcaaggatacaaaaagtgacatcatattctttcagaga
agtgtcccaggacatgataataagatgcaatttgaatcttcatcatacgaaggatacttt
ctagcttgtgaaaaagagagagacctttttaaactcattttgaaaaaagaggatgaattg
ggggatagatctataatgttcactgttcaaaacgaagactag

DBGET integrated database retrieval system