KEGG   Homo sapiens (human): 3606Help
Entry
3606              CDS       T01001                                 

Gene name
IL18, IGIF, IL-18, IL-1g, IL1F4
Definition
(RefSeq) interleukin 18
  KO
K05482  interleukin 18
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa05132  Salmonella infection
hsa05134  Legionellosis
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05321  Inflammatory bowel disease (IBD)
hsa05323  Rheumatoid arthritis
Disease
H01360  Allergic rhinitis
H01516  Adult onset Still disease
Drug target
Iboctadekin: D04487
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3606 (IL18)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    3606 (IL18)
   04623 Cytosolic DNA-sensing pathway
    3606 (IL18)
 09160 Human Diseases
  09163 Immune diseases
   05323 Rheumatoid arthritis
    3606 (IL18)
   05321 Inflammatory bowel disease (IBD)
    3606 (IL18)
  09171 Infectious diseases: Bacterial
   05132 Salmonella infection
    3606 (IL18)
   05134 Legionellosis
    3606 (IL18)
   05152 Tuberculosis
    3606 (IL18)
  09172 Infectious diseases: Viral
   05164 Influenza A
    3606 (IL18)
  09174 Infectious diseases: Parasitic
   05144 Malaria
    3606 (IL18)
   05143 African trypanosomiasis
    3606 (IL18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3606 (IL18)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3606 (IL18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1 RMP
Motif
Other DBs
NCBI-GeneID: 3606
NCBI-ProteinID: NP_001553
OMIM: 600953
HGNC: 5986
Ensembl: ENSG00000150782
Vega: OTTHUMG00000167006
Pharos: Q14116(Tbio)
UniProt: Q14116
Structure
PDB: 

Position
11q23.1
AA seq 193 aa AA seqDB search
MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQ
GNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFK
EMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDEL
GDRSIMFTVQNED
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgaaccagtagaagacaattgcatcaactttgtggcaatgaaatttattgac
aatacgctttactttatagctgaagatgatgaaaacctggaatcagattactttggcaag
cttgaatctaaattatcagtcataagaaatttgaatgaccaagttctcttcattgaccaa
ggaaatcggcctctatttgaagatatgactgattctgactgtagagataatgcaccccgg
accatatttattataagtatgtataaagatagccagcctagaggtatggctgtaactatc
tctgtgaagtgtgagaaaatttcaactctctcctgtgagaacaaaattatttcctttaag
gaaatgaatcctcctgataacatcaaggatacaaaaagtgacatcatattctttcagaga
agtgtcccaggacatgataataagatgcaatttgaatcttcatcatacgaaggatacttt
ctagcttgtgaaaaagagagagacctttttaaactcattttgaaaaaagaggatgaattg
ggggatagatctataatgttcactgttcaaaacgaagactag

DBGET integrated database retrieval system