KEGG   Homo sapiens (human): 3607
Entry
3607              CDS       T01001                                 
Symbol
FOXK2, ILF, ILF-1, ILF1, nGTBP
Name
(RefSeq) forkhead box K2
  KO
K09404  forkhead box protein K
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3607 (FOXK2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    3607 (FOXK2)
SSDB
Motif
Pfam: Forkhead FHA
Other DBs
NCBI-GeneID: 3607
NCBI-ProteinID: NP_004505
OMIM: 147685
HGNC: 6036
Ensembl: ENSG00000141568
Pharos: Q01167(Tbio)
UniProt: Q01167
Structure
Position
17:82519732..82604602
AA seq 660 aa
MAAAAAALSGAGTPPAGGGAGGGGAGGGGSPPGGWAVARLEGREFEYLMKKRSVTIGRNS
SQGSVDVSMGHSSFISRRHLEIFTPPGGGGHGGAAPELPPAQPRPDAGGDFYLRCLGKNG
VFVDGVFQRRGAPPLQLPRVCTFRFPSTNIKITFTALSSEKREKQEASESPVKAVQPHIS
PLTINIPDTMAHLISPLPSPTGTISAANSCPSSPRGAGSSGYKVGRVMPSDLNLMADNSQ
PENEKEASGGDSPKDDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADK
GWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKRRPRGVPCFRT
PLGPLSSRSAPASPNHAGVLSAHSSGAQTPESLSREGSPAPLEPEPGAAQPKLAVIQEAR
FAQSAPGSPLSSQPVLITVQRQLPQAIKPVTYTVATPVTTSTSQPPVVQTVHVVHQIPAV
SVTSVAGLAPANTYTVSGQAVVTPAAVLAPPKAEAQENGDHREVKVKVEPIPAIGHATLG
TASRIIQTAQTTPVQTVTIVQQAPLGQHQLPIKTVTQNGTHVASVPTAVHGQVNNAAASP
LHMLATHASASASLPTKRHNGDQPEQPELKRIKTEDGEGIVIALSVDTPPAAVREKGVQN
NT seq 1983 nt   +upstreamnt  +downstreamnt
atggcggcggccgcggcggcgctctcgggcgcgggcacgccacccgcgggcggcggggcc
gggggcggcggggccgggggcggcgggtccccgccgggcggctgggccgtggcgcgcctg
gagggccgcgagttcgagtatctgatgaagaagcgctcggtgaccatcggccgcaactcg
tcgcagggctcggtggacgtgagcatgggccactcgagcttcatctcccggcgccacctc
gagatcttcacgcccccgggcggcggcggccatggcggggccgctccggagctgccgccc
gcgcagcccaggcccgacgccggcggcgacttctacctgcgctgcttgggcaagaacggg
gtattcgtggacggcgtgttccagaggcgcggggcgccgccgctgcagctgccgcgcgtg
tgcacattcaggttcccgagcacaaacatcaagataacgttcactgccctgtccagcgag
aagagagagaagcaggaggcgtctgagtctccagtgaaggccgtacagccacacatctcg
cccctgaccatcaacattccagacaccatggcccacctcatcagccctctgccctccccc
acgggaaccatcagcgctgcaaactcctgcccctccagcccccggggagcggggtcttca
gggtacaaggtgggccgagtgatgccatctgacctcaatttaatggctgacaactcacag
cctgaaaatgaaaaggaagcttcaggtggagacagcccgaaggatgattcaaagccgcct
tactcctacgcgcagctgatagttcaggcgattacgatggctcccgacaaacagctcacc
ctgaacgggatttatacacacatcactaaaaattatccctactacaggactgcggacaag
ggctggcagaattcaattcgccacaatctctctctgaatcgttatttcatcaaagtgccg
cgttcccaggaagaaccaggcaaaggctcgttctggaggatagacccagcctctgaaagc
aaattaatagaacaggcttttaggaaacgacggcctaggggcgtgccctgctttagaacc
cctctgggaccgctctcttctaggagtgccccagcctctcccaatcacgcgggagtgctg
tctgctcactctagtggcgcccagacccctgagagcctgtcgagggaaggttcgccggcc
cccctggagcctgagcctggcgctgcacagcccaaactcgctgtcatccaggaagcccgg
tttgcccagagcgccccagggtcacctctgtccagtcagccagtcttaatcaccgtccag
cggcagctaccacaggccatcaagcctgtcacctacactgtggccaccccagtgaccacc
tcgacctcccagccacccgtcgtgcagacggttcacgtcgtccaccagatcccagcggtg
tcggtcaccagtgtggccggactggccccagcgaacacgtacactgtctctggacaagct
gtggtcaccccggcagccgtgctggcccctcctaaggcagaggcccaggagaatggagac
cacagggaagtcaaagtgaaagtagagcctattcccgccattggccacgccacgctcggc
actgccagccggatcattcagacggcacagaccaccccggtccagacggtgaccatagta
caacaggcacctctaggtcaacaccagctaccaataaaaactgtaacacaaaacggcact
cacgtggcatcagtccccactgcggtccacggccaggtgaacaatgccgcggcgagtcct
ttgcacatgttggcaacacacgcatccgcatcggcctccctgcccacaaagcgccacaac
ggtgaccagccggagcagccggagctgaagcggatcaagacagaagacggcgagggcatc
gtcattgccctgagcgtggacacgccaccggcagccgtaagggaaaagggtgtccagaac
tag

DBGET integrated database retrieval system