KEGG   Homo sapiens (human): 3619Help
Entry
3619              CDS       T01001                                 

Gene name
INCENP
Definition
(RefSeq) inner centromere protein
  KO
K11515  inner centromere protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3619 (INCENP)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     3619 (INCENP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: INCENP_N INCENP_ARK-bind
Motif
Other DBs
NCBI-GeneID: 3619
NCBI-ProteinID: NP_001035784
OMIM: 604411
HGNC: 6058
Ensembl: ENSG00000149503
Vega: OTTHUMG00000167470
Pharos: Q9NQS7(Tbio)
UniProt: Q9NQS7
Structure
PDB: 

Position
11q12.3
AA seq 918 aa AA seqDB search
MGTTAPGPIHLLELCDQKLMEFLCNMDNKDLVWLEEIQEEAERMFTREFSKEPELMPKTP
SQKNRRKKRRISYVQDENRDPIRRRLSRRKSRSSQLSSRRLRSKDSVEKLATVVGENGSV
LRRVTRAAAAAAAATMALAAPSSPTPESPTMLTKKPEDNHTQCQLVPVVEIGISERQNAE
QHVTQLMSTEPLPRTLSPTPASATAPTSQGIPTSDEESTPKKSKARILESITVSSLMATP
QDPKGQGVGTGRSASKLRIAQVSPGPRDSPAFPDSPWRERVLAPILPDNFSTPTGSRTDS
QSVRHSPIAPSSPSPQVLAQKYSLVAKQESVVRRASRRLAKKTAEEPAASGRIICHSYLE
RLLNVEVPQKVGSEQKEPPEEAEPVAAAEPEVPENNGNNSWPHNDTEIANSTPNPKPAAS
SPETPSAGQQEAKTDQADGPREPPQSARRKRSYKQAVSELDEEQHLEDEELQPPRSKTPS
SPCPASKVVRPLRTFLHTVQRNQMLMTPTSAPRSVMKSFIKRNTPLRMDPKCSFVEKERQ
RLENLRRKEEAEQLRRQKVEEDKRRRLEEVKLKREERLRKVLQARERVEQMKEEKKKQIE
QKFAQIDEKTEKAKEERLAEEKAKKKAAAKKMEEVEARRKQEEEARRLRWLQQEEEERRH
QELLQKKKEEEQERLRKAAEAKRLAEQREQERREQERREQERREQERREQERREQERQLA
EQERRREQERLQAERELQEREKALRLQKEQLQRELEEKKKKEEQQRLAERQLQEEQEKKA
KEAAGASKALNVTVDVQSPACTSYQMTPQGHRAPPKINPDNYGMDLNSDDSTDDEAHPRK
PIPTWARGTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFKKSKPRYHKRTSSAVWNSP
PLQGARVPSSLAYSLKKH
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggggacgacggccccagggcccattcacctgctggagctatgtgaccagaagctcatg
gagtttctctgcaacatggataataaggacttggtgtggcttgaggaaatccaagaggag
gccgagcgcatgttcaccagagaattcagcaaagagccagagctgatgcccaaaacacct
tctcagaagaaccgacggaagaagagacggatttcttatgttcaggatgaaaacagagat
cccatcaggagaaggttatcccgcagaaagtctcggagcagccagctgagctcccgacgc
ctccgcagcaaggacagtgtagagaagctggctacagtggtcggggagaacggctccgtc
ctgcggcgtgtgacccgtgctgcggctgcagctgccgcggctaccatggcattggctgca
ccttcttcacccacccctgagtctcccacgatgctgactaagaagcccgaggataaccac
acccagtgccagctggtgcctgtggtggagatcggcatcagtgagcgccagaatgctgag
cagcatgtcacccagctcatgtccaccgagcctctgccccgcactctgtccccgactcca
gcttcagccacagctccaacctcccagggcatcccgacatcagatgaggaatcaacacct
aagaagtcgaaggccaggatactggagtccatcacagtgagctccctgatggctacaccc
caggaccccaagggtcaaggggtcgggacggggcggtctgcgtctaagctcaggattgcg
caggtctcccctggcccacgggactcgccagcctttccagattctccatggcgggagcgg
gtgctggctcccatcctgccggataacttctccacgcccacgggctctcgcacggactct
caatcggtgcggcacagcccgatcgccccgtcttccccgagtccccaagtcttagcccag
aagtactctctggtggccaaacaggaaagtgttgtccgcagggcgagcagaaggcttgcc
aagaagactgccgaagagccagctgcctctggccgcatcatctgtcacagttacctggag
aggctcctgaatgttgaggtgccccagaaagttggttctgagcagaaggaaccccccgag
gaggctgagcctgtggcggcagctgagccagaggtccctgagaacaatggaaataactcg
tggccccacaatgacacggagattgccaacagcacacccaacccgaagcctgcagccagc
agcccggaaacaccctctgcagggcagcaagaggccaagacggaccaagcagatggaccc
agagagccaccgcagagtgccaggaggaagcgcagctacaagcaggccgtgagtgagctg
gacgaggagcagcacctggaggatgaggagctgcagccccccaggagcaagaccccttcc
tcaccctgcccagccagcaaggtggtacggcccctccggacctttctgcacacagtgcag
aggaaccagatgctcatgaccccgacctcagccccacgcagcgtcatgaagtcctttatt
aagcgcaacactcccctgcgcatggaccccaagtgcagcttcgtcgagaaggagcggcag
cgcctggagaatctgcggcggaaggaggaggccgagcagctgcgcaggcagaaggtggag
gaggacaagcggcggcggctggaggaggtgaagctgaagcgtgaggaacgcctccgcaag
gtgctgcaggcccgcgagcgggtggagcagatgaaggaggagaagaagaagcagattgag
cagaagtttgctcagatcgacgagaagactgagaaggccaaggaggagcggctggcagag
gagaaggccaagaaaaaggcggcggccaagaagatggaggaggtggaagcacgcaggaag
caggaagaggaggcacgtaggctcaggtggctgcagcaggaggaggaagagcggcggcac
caagagctgctgcagaagaagaaggaagaggagcaggagcggctgcggaaggcggccgag
gctaagcggctggcagagcagcgggagcaggagcggcgggagcaggagcggcgcgagcag
gagcggcgcgagcaggagcggcgggagcaggagcggcgcgagcaggagcgacagctggca
gagcaggagcgtcggcgggagcaggagcggctccaggccgagagggagctgcaggagcgg
gagaaggccctgcggctgcagaaggagcagctgcagagggaactggaggagaagaagaag
aaggaagagcagcagcgtctggctgagcggcagctgcaggaggagcaagagaagaaagcc
aaggaggcagcaggggccagcaaggccctgaatgtgactgtggacgtgcagtctccagct
tgtacctcatatcagatgactccgcaagggcacagggcccctcccaagatcaacccagat
aactacgggatggatctgaatagcgacgactccaccgatgatgaggcccatccccggaag
cccatccccacctgggcccgaggcaccccgctcagccaggctatcattcaccagtactac
cacccaccgaaccttctggagctctttggaaccattctcccactggacttggaggatatc
ttcaagaagagcaagccccgctatcacaagcgcaccagctctgctgtctggaactcaccg
cccctgcagggcgccagggtccccagcagcctggcctacagcctgaagaagcactga

DBGET integrated database retrieval system