KEGG   Homo sapiens (human): 362Help
Entry
362               CDS       T01001                                 

Gene name
AQP5, AQP-5, PPKB
Definition
(RefSeq) aquaporin 5
  KO
K09867  aquaporin-5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
Disease
H02266  Palmoplantar keratoderma, Bothnian type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    362 (AQP5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    362 (AQP5)
Transporters [BR:hsa02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    362 (AQP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-GeneID: 362
NCBI-ProteinID: NP_001642
OMIM: 600442
HGNC: 638
Ensembl: ENSG00000161798
Vega: OTTHUMG00000169710
Pharos: P55064(Tbio)
UniProt: P55064
Structure
PDB: 

Position
12q13.12
AA seq 265 aa AA seqDB search
MKKEVCSVAFLKAVFAEFLATLIFVFFGLGSALKWPSALPTILQIALAFGLAIGTLAQAL
GPVSGGHINPAITLALLVGNQISLLRAFFYVAAQLVGAIAGAGILYGVAPLNARGNLAVN
ALNNNTTQGQAMVVELILTFQLALCIFASTDSRRTSPVGSPALSIGLSVTLGHLVGIYFT
GCSMNPARSFGPAVVMNRFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIK
GTYEPDEDWEEQREERKKTMELTTR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggaggtgtgctccgtggccttcctcaaggccgtgttcgcagagttcttggcc
accctcatcttcgtcttctttggcctgggctcggccctcaagtggccgtcggcgctgcct
accatcctgcagatcgcgctggcgtttggcctggccataggcacgctggcccaggccctg
ggacccgtgagcggcggccacatcaaccccgccatcaccctggccctcttggtgggcaac
cagatctcgctgctccgggctttcttctacgtggcggcccagctggtgggcgccattgcc
ggggctggcatcctctacggtgtggcaccgctcaatgcccggggcaatctggccgtcaac
gcgctcaacaacaacacaacgcagggccaggccatggtggtggagctgattctgaccttc
cagctggcactctgcatcttcgcctccactgactcccgccgcaccagccctgtgggctcc
ccagccctgtccattggcctgtctgtcaccctgggccaccttgtcggaatctacttcact
ggctgctccatgaacccagcccgctcttttggccctgcggtggtcatgaatcggttcagc
cccgctcactgggttttctgggtagggcccatcgtgggggcggtcctggctgccatcctt
tacttctacctgctcttccccaactccctgagcctgagtgagcgtgtggccatcatcaaa
ggcacgtatgagcctgacgaggactgggaggagcagcgggaagagcggaagaagaccatg
gagctgaccacccgctga

DBGET integrated database retrieval system