KEGG   Homo sapiens (human): 3624Help
Entry
3624              CDS       T01001                                 

Gene name
INHBA, EDF, FRP
Definition
(RefSeq) inhibin subunit beta A
  KO
K04667  inhibin beta A chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Module
hsa_M00681  Activin signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    3624 (INHBA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3624 (INHBA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3624 (INHBA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3624 (INHBA)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   3624 (INHBA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta TGFb_propeptide
Motif
Other DBs
NCBI-GeneID: 3624
NCBI-ProteinID: NP_002183
OMIM: 147290
HGNC: 6066
Ensembl: ENSG00000122641
Vega: OTTHUMG00000023574
Pharos: P08476(Tbio)
CPD: C18208 C17813
UniProt: P08476 A4D1W7
Structure
PDB: 

Position
7p14.1
AA seq 426 aa AA seqDB search
MPLLWLRGFLLASCWIIVRSSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKK
HILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQT
SEIITFAESGTARKTLHFEISKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQK
HPQGSLDTGEEAEEVGLKGERSELLLSEKVVDARKSTWHVFPVSSSIQRLLDQGKSSLDV
RIACEQCQESGASLVLLGKKKKKEEEGEGKKKGGGEGGAGADEEKEQSHRPFLMLQARQS
EDHPHRRRRRGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAG
TSGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIV
EECGCS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcccttgctttggctgagaggatttctgttggcaagttgctggattatagtgaggagt
tcccccaccccaggatccgaggggcacagcgcggcccccgactgtccgtcctgtgcgctg
gccgccctcccaaaggatgtacccaactctcagccagagatggtggaggccgtcaagaag
cacattttaaacatgctgcacttgaagaagagacccgatgtcacccagccggtacccaag
gcggcgcttctgaacgcgatcagaaagcttcatgtgggcaaagtcggggagaacgggtat
gtggagatagaggatgacattggaaggagggcagaaatgaatgaacttatggagcagacc
tcggagatcatcacgtttgccgagtcaggaacagccaggaagacgctgcacttcgagatt
tccaaggaaggcagtgacctgtcagtggtggagcgtgcagaagtctggctcttcctaaaa
gtccccaaggccaacaggaccaggaccaaagtcaccatccgcctcttccagcagcagaag
cacccgcagggcagcttggacacaggggaagaggccgaggaagtgggcttaaagggggag
aggagtgaactgttgctctctgaaaaagtagtagacgctcggaagagcacctggcatgtc
ttccctgtctccagcagcatccagcggttgctggaccagggcaagagctccctggacgtt
cggattgcctgtgagcagtgccaggagagtggcgccagcttggttctcctgggcaagaag
aagaagaaagaagaggagggggaagggaaaaagaagggcggaggtgaaggtggggcagga
gcagatgaggaaaaggagcagtcgcacagacctttcctcatgctgcaggcccggcagtct
gaagaccaccctcatcgccggcgtcggcggggcttggagtgtgatggcaaggtcaacatc
tgctgtaagaaacagttctttgtcagtttcaaggacatcggctggaatgactggatcatt
gctccctctggctatcatgccaactactgcgagggtgagtgcccgagccatatagcaggc
acgtccgggtcctcactgtccttccactcaacagtcatcaaccactaccgcatgcggggc
catagcccctttgccaacctcaaatcgtgctgtgtgcccaccaagctgagacccatgtcc
atgttgtactatgatgatggtcaaaacatcatcaaaaaggacattcagaacatgatcgtg
gaggagtgtgggtgctcatag

KEGG   Homo sapiens (human): 3625Help
Entry
3625              CDS       T01001                                 

Gene name
INHBB
Definition
(RefSeq) inhibin subunit beta B
  KO
K22687  inhibin beta B chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    3625 (INHBB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3625 (INHBB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3625 (INHBB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3625 (INHBB)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   3625 (INHBB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta TGFb_propeptide US22 TctA
Motif
Other DBs
NCBI-GeneID: 3625
NCBI-ProteinID: NP_002184
OMIM: 147390
HGNC: 6067
Ensembl: ENSG00000163083
Vega: OTTHUMG00000131437
Pharos: P09529(Tbio)
CPD: C18208 C18209
UniProt: P09529
Position
2q14.2
AA seq 407 aa AA seqDB search
MDGLPGRALGAACLLLLAAGWLGPEAWGSPTPPPTPAAPPPPPPPGSPGGSQDTCTSCGG
FRRPEELGRVDGDFLEAVKRHILSRLQMRGRPNITHAVPKAAMVTALRKLHAGKVREDGR
VEIPHLDGHASPGADGQERVSEIISFAETDGLASSRVRLYFFISNEGNQNLFVVQASLWL
YLKLLPYVLEKGSRRKVRVKVYFQEQGHGDRWNMVEKRVDLKRSGWHTFPLTEAIQALFE
RGERRLNLDVQCDSCQELAVVPVFVDPGEESHRPFVVVQARLGDSRHRIRKRGLECDGRT
NLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRM
RGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggacgggctgcccggtcgggcgctgggggccgcctgccttctgctgctggcggccggc
tggctggggcctgaggcctggggctcacccacgcccccgccgacgcctgccgcgccgccg
ccacccccgccacccggatccccgggtggctcgcaggacacctgtacgtcgtgcggcggc
ttccggcggccagaggagctcggccgagtggacggcgacttcctggaggcggtgaagcgg
cacatcttgagccgcctgcagatgcggggccggcccaacatcacgcacgccgtgcctaag
gccgccatggtcacggccctgcgcaagctgcacgcgggcaaggtgcgcgaggacggccgc
gtggagatcccgcacctcgacggccacgccagcccgggcgccgacggccaggagcgcgtt
tccgaaatcatcagcttcgccgagacagatggcctcgcctcctcccgggtccgcctatac
ttcttcatctccaacgaaggcaaccagaacctgtttgtggtccaggccagcctgtggctt
tacctgaaactcctgccctacgtcctggagaagggcagccggcggaaggtgcgggtcaaa
gtgtacttccaggagcagggccacggtgacaggtggaacatggtggagaagagggtggac
ctcaagcgcagcggctggcataccttcccactcacggaggccatccaggccttgtttgag
cggggcgagcggcgactcaacctagacgtgcagtgtgacagctgccaggagctggccgtg
gtgccggtgttcgtggacccaggcgaagagtcgcaccggccctttgtggtggtgcaggct
cggctgggcgacagcaggcaccgcattcgcaagcgaggcctggagtgcgatggccggacc
aacctctgttgcaggcaacagttcttcattgacttccgcctcatcggctggaacgactgg
atcatagcacccaccggctactacgggaactactgtgagggcagctgcccagcctacctg
gcaggggtccccggctctgcctcctccttccacacggctgtggtgaaccagtaccgcatg
cggggtctgaaccccggcacggtgaactcctgctgcattcccaccaagctgagcaccatg
tccatgctgtacttcgatgatgagtacaacatcgtcaagcgggacgtgcccaacatgatt
gtggaggagtgcggctgcgcctga

KEGG   Homo sapiens (human): 3626Help
Entry
3626              CDS       T01001                                 

Gene name
INHBC, IHBC
Definition
(RefSeq) inhibin subunit beta C
  KO
K22688  inhibin beta C chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    3626 (INHBC)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3626 (INHBC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3626 (INHBC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3626 (INHBC)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   3626 (INHBC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta Anti-TRAP
Motif
Other DBs
NCBI-GeneID: 3626
NCBI-ProteinID: NP_005529
OMIM: 601233
HGNC: 6068
Ensembl: ENSG00000175189
Vega: OTTHUMG00000169994
Pharos: P55103(Tbio)
UniProt: P55103
Position
12q13.3
AA seq 352 aa AA seqDB search
MTSSLLLAFLLLAPTTVATPRAGGQCPACGGPTLELESQRELLLDLAKRSILDKLHLTQR
PTLNRPVSRAALRTALQHLHGVPQGALLEDNREQECEIISFAETGLSTINQTRLDFHFSS
DRTAGDREVQQASLMFFVQLPSNTTWTLKVRVLVLGPHNTNLTLATQYLLEVDASGWHQL
PLGPEAQAACSQGHLTLELVLEGQVAQSSVILGGAAHRPFVAARVRVGGKHQIHRRGIDC
QGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLN
LLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacctcctcattgcttctggcctttctcctcctggctccaaccacagtggccactccc
agagctggcggtcagtgtccagcatgtggggggcccaccttggaactggagagccagcgg
gagctgcttcttgatctggccaagagaagcatcttggacaagctgcacctcacccagcgc
ccaacactgaaccgccctgtgtccagagctgctttgaggactgcactgcagcacctccac
ggggtcccacagggggcacttctagaggacaacagggaacaggaatgtgaaatcatcagc
tttgctgagacaggcctctccaccatcaaccagactcgtcttgattttcacttctcctct
gatagaactgctggtgacagggaggtccagcaggccagtctcatgttctttgtgcagctc
ccttccaataccacttggaccttgaaagtgagagtccttgtgctgggtccacataatacc
aacctcaccttggctactcagtacctgctggaggtggatgccagtggctggcatcaactc
cccctagggcctgaagctcaagctgcctgcagccaggggcacctgaccctggagctggta
cttgaaggccaggtagcccagagctcagtcatcctgggtggagctgcccataggcctttt
gtggcagcccgggtgagagttgggggcaaacaccagattcaccgacgaggcatcgactgc
caaggagggtccaggatgtgctgtcgacaagagttttttgtggacttccgtgagattggc
tggcacgactggatcatccagcctgagggctacgccatgaacttctgcatagggcagtgc
ccactacacatagcaggcatgcctggtattgctgcctcctttcacactgcagtgctcaat
cttctcaaggccaacacagctgcaggcaccactggagggggctcatgctgtgtacccacg
gcccggcgccccctgtctctgctctattatgacagggacagcaacattgtcaagactgac
atacctgacatggtagtagaggcctgtgggtgcagttag

KEGG   Homo sapiens (human): 83729Help
Entry
83729             CDS       T01001                                 

Gene name
INHBE
Definition
(RefSeq) inhibin subunit beta E
  KO
K22689  inhibin beta E chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    83729 (INHBE)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    83729 (INHBE)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    83729 (INHBE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    83729 (INHBE)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   83729 (INHBE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta Anti-TRAP
Motif
Other DBs
NCBI-GeneID: 83729
NCBI-ProteinID: NP_113667
OMIM: 612031
HGNC: 24029
Ensembl: ENSG00000139269
Vega: OTTHUMG00000169995
Pharos: P58166(Tbio)
UniProt: P58166
Position
12q13.3
AA seq 350 aa AA seqDB search
MRLPDVQLWLVLLWALVRAQGTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSR
PRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHH
LYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRG
EKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTC
EPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFS
LLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcggctccctgatgtccagctctggctggtgctgctgtgggcactggtgcgagcacag
gggacagggtctgtgtgtccctcctgtgggggctccaaactggcaccccaagcagaacga
gctctggtgctggagctagccaagcagcaaatcctggatgggttgcacctgaccagtcgt
cccagaataactcatcctccaccccaggcagcgctgaccagagccctccggagactacag
ccagggagtgtggctccagggaatggggaggaggtcatcagctttgctactgtcacagac
tccacttcagcctacagctccctgctcacttttcacctgtccactcctcggtcccaccac
ctgtaccatgcccgcctgtggctgcacgtgctccccacccttcctggcactctttgcttg
aggatcttccgatggggaccaaggaggaggcgccaagggtcccgcactctcctggctgag
caccacatcaccaacctgggctggcataccttaactctgccctctagtggcttgaggggt
gagaagtctggtgtcctgaaactgcaactagactgcagacccctagaaggcaacagcaca
gttactggacaaccgaggcggctcttggacacagcaggacaccagcagcccttcctagag
cttaagatccgagccaatgagcctggagcaggccgggccaggaggaggacccccacctgt
gagcctgcgacccccttatgttgcaggcgagaccattacgtagacttccaggaactggga
tggcgggactggatactgcagcccgaggggtaccagctgaattactgcagtgggcagtgc
cctccccacctggctggcagcccaggcattgctgcctctttccattctgccgtcttcagc
ctcctcaaagccaacaatccttggcctgccagtacctcctgttgtgtccctactgcccga
aggcccctctctctcctctacctggatcataatggcaatgtggtcaagacggatgtgcca
gatatggtggtggaggcctgtggctgcagctag

DBGET integrated database retrieval system