KEGG   Homo sapiens (human): 3627Help
Entry
3627              CDS       T01001                                 

Gene name
CXCL10, C7, IFI10, INP10, IP-10, SCYB10, crg-2, gIP-10, mob-1
Definition
(RefSeq) C-X-C motif chemokine ligand 10
  KO
K12671  C-X-C motif chemokine 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05164  Influenza A
hsa05169  Epstein-Barr virus infection
Network
N00471  EBV LMP2A/2B to IFN signaling pathway
N00472  EBV LMP1 to IFN signaling pathway
N00473  EBV BGLF4 to IFN signaling pathway
Disease
H01360  Allergic rhinitis
Drug target
Eldelumab: D10404
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    3627 (CXCL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3627 (CXCL10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3627 (CXCL10)
   04622 RIG-I-like receptor signaling pathway
    3627 (CXCL10)
   04623 Cytosolic DNA-sensing pathway
    3627 (CXCL10)
   04657 IL-17 signaling pathway
    3627 (CXCL10)
   04062 Chemokine signaling pathway
    3627 (CXCL10)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    3627 (CXCL10)
   05169 Epstein-Barr virus infection
    3627 (CXCL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3627 (CXCL10)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3627 (CXCL10)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   3627 (CXCL10)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines
   3627 (CXCL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 3627
NCBI-ProteinID: NP_001556
OMIM: 147310
HGNC: 10637
Ensembl: ENSG00000169245
Vega: OTTHUMG00000160887
Pharos: P02778(Tbio)
UniProt: P02778 A0A024RDA4
Structure
PDB: 

Position
4q21.1
AA seq 98 aa AA seqDB search
MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRV
EIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaactgccattctgatttgctgccttatctttctgactctaagtggcattcaa
ggagtacctctctctagaactgtacgctgtacctgcatcagcattagtaatcaacctgtt
aatccaaggtctttagaaaaacttgaaattattcctgcaagccaattttgtccacgtgtt
gagatcattgctacaatgaaaaagaagggtgagaagagatgtctgaatccagaatcgaag
gccatcaagaatttactgaaagcagttagcaaggaaaggtctaaaagatctccttaa

DBGET integrated database retrieval system