KEGG   Homo sapiens (human): 3628Help
Entry
3628              CDS       T01001                                 

Gene name
INPP1
Definition
(RefSeq) inositol polyphosphate-1-phosphatase
  KO
K01107  inositol polyphosphate 1-phosphatase [EC:3.1.3.57]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00131  Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    3628 (INPP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    3628 (INPP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.57  inositol-1,4-bisphosphate 1-phosphatase
     3628 (INPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-GeneID: 3628
NCBI-ProteinID: NP_001122400
OMIM: 147263
HGNC: 6071
Ensembl: ENSG00000151689
Vega: OTTHUMG00000132672
Pharos: P49441(Tbio)
UniProt: P49441 Q6IBG4
Position
2q32.2
AA seq 399 aa AA seqDB search
MSDILRELLCVSEKAANIARACRQQEALFQLLIEEKKEGEKNKKFAVDFKTLADVLVQEV
IKQNMENKFPGLEKNIFGEESNEFTNDWGEKITLRLCSTEEETAELLSKVLNGNKVASEA
LARVVHQDVAFTDPTLDSTEINVPQDILGIWVDPIDSTYQYIKGSADIKSNQGIFPCGLQ
CVTILIGVYDIQTGVPLMGVINQPFVSRDPNTLRWKGQCYWGLSYMGTNMHSLQLTISRR
NGSETHTGNTGSEAAFSPSFSAVISTSEKETIKAALSRVCGDRIFGAAGAGYKSLCVVQG
LVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQLVYHVENEGA
AGVDRWANKGGLIAYRSRKRLETFLSLLVQNLAPAETHT
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatatcctccgggagctgctctgtgtctctgagaaggctgctaacattgcccgg
gcgtgcagacagcaggaagccctcttccagctgctgatcgaagaaaagaaagagggagaa
aagaacaagaagtttgcagttgacttcaagacgctggctgatgtactggtacaggaagtt
ataaaacagaatatggagaacaagtttccaggcttggaaaaaaatatttttggagaagaa
tccaatgagtttactaatgactggggggaaaagattaccttgaggttgtgttcaacagag
gaggaaacagcagagcttcttagcaaagtcctcaatggtaacaaggtggcatctgaagca
ttagccagggttgttcatcaggatgttgcctttactgacccaactctggattccacagag
atcaatgttccacaggacattttgggaatttgggtggaccccatagattcaacttatcag
tatataaaaggttctgctgacattaaatccaaccagggaatcttcccctgtggacttcag
tgtgtcaccattttaattggtgtctatgacatacagacaggggttcccctgatgggagtc
atcaatcaaccttttgtgtcacgagatccaaacaccctcaggtggaaaggacagtgctat
tggggcctttcttacatggggaccaacatgcattcactacagctcaccatctctagaaga
aacggcagtgaaacacacactggaaacaccggctctgaggcagcattctcccccagtttt
tcagccgtaattagtacaagtgaaaaggagactatcaaagctgcattgtcacgtgtgtgt
ggagatcgcatatttggggcagctggggctggttataagagcctatgtgttgtccaaggc
ctcgttgacatttacatcttttcagaagataccacattcaaatgggactcttgtgctgct
catgccatactgagggccatgggtgggggaatagtagacttgaaagaatgcttagaaaga
aatccagaaacagggcttgatttgccacagttggtgtaccacgtggaaaatgagggtgct
gctggggtggatcggtgggccaacaagggaggactcattgcatacagatccaggaagcgg
ctggagacattcctgagcctcctggtccaaaacctggcacctgcagagacgcatacctag

DBGET integrated database retrieval system