KEGG   Homo sapiens (human): 363
Entry
363               CDS       T01001                                 
Symbol
AQP6, AQP2L, KID
Name
(RefSeq) aquaporin 6
  KO
K09868  aquaporin-6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    363 (AQP6)
Transporters [BR:hsa02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    363 (AQP6)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 363
NCBI-ProteinID: NP_001643
OMIM: 601383
HGNC: 639
Ensembl: ENSG00000086159
Pharos: Q13520(Tbio)
UniProt: Q13520
Position
12:49972947..49977139
AA seq 282 aa
MDAVEPGGRGWASMLACRLWKAISRALFAEFLATGLYVFFGVGSVMRWPTALPSVLQIAI
TFNLVTAMAVQVTWKASGAHANPAVTLAFLVGSHISLPRAVAYVAAQLVGATVGAALLYG
VMPGDIRETLGINVVRNSVSTGQAVAVELLLTLQLVLCVFASTDSRQTSGSPATMIGISV
ALGHLIGIHFTGCSMNPARSFGPAIIIGKFTVHWVFWVGPLMGALLASLIYNFVLFPDTK
TLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEMESV
NT seq 849 nt   +upstreamnt  +downstreamnt
atggatgcagtggagccagggggacgtggctgggccagcatgttggcgtgcaggctttgg
aaagccatcagcagggcgctgtttgcagagttcctggccacggggctgtatgtgttcttt
ggcgtgggctcagtcatgcgctggcccacagcacttccctccgtgctacagattgccatc
accttcaacctggtcaccgccatggctgtgcaggtcacctggaaggccagcggggcccac
gccaaccccgccgtgacgctggccttcctcgtaggctcccacatctctctgccccgtgct
gtggcctatgtggctgcccagctggtgggggccacggtgggggctgctctgctttatggg
gtcatgccgggagacatccgagagacccttgggatcaacgtggtccggaacagtgtctca
actggccaggcggtggcagtggagctgcttctgaccctgcagctggtgctctgtgtcttc
gcttccaccgacagccgtcagacatcaggctccccggccaccatgattgggatctctgtg
gcactgggccacctcattgggatccacttcactggctgctccatgaatccagcccgctcc
ttcggccctgccatcatcattgggaagttcacagtccactgggtcttctgggtggggccc
ctgatgggagccctcctggcctcactgatctacaacttcgtcctgttccccgacaccaag
accctggcgcagcggctggctatcctcacaggcaccgtagaggtggggacaggggcaggg
gcaggggcggagcccctgaagaaggaatcccagccgggttcgggagccgtggagatggag
agtgtgtga

DBGET integrated database retrieval system