KEGG   Homo sapiens (human): 3632Help
Entry
3632              CDS       T01001                                 

Gene name
INPP5A, 5PTASE
Definition
(RefSeq) inositol polyphosphate-5-phosphatase A
  KO
K01106  inositol-1,4,5-trisphosphate 5-phosphatase [EC:3.1.3.56]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00131  Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    3632 (INPP5A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    3632 (INPP5A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.56  inositol-polyphosphate 5-phosphatase
     3632 (INPP5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exo_endo_phos Glyco_hydro_cc OLF
Motif
Other DBs
NCBI-GeneID: 3632
NCBI-ProteinID: NP_005530
OMIM: 600106
HGNC: 6076
Ensembl: ENSG00000068383
Vega: OTTHUMG00000019293
Pharos: Q14642(Tbio)
UniProt: Q14642
Position
10q26.3
AA seq 412 aa AA seqDB search
MAGKAAAPGTAVLLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKN
YEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQF
DFKAKKYRKVAGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDL
VNIHLFHDASNLVAWETSPSVYSGIRHKALGYVLDRIIDQRFEKVSYFVFGDFNFRLDSK
SVVETLCTKATMQTVRAADTNEVVKLIFRESDNDRKVMLQLEKKLFDYFNQEVFRDNNGT
ALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKEL
VLRSESEEKVVTYDHIGPNVCMGDHKPVFLAFRIMPGAGKPHAHVHKCCVVQ
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaaggcggccgccccgggcaccgcggtgctgctggtcacggccaacgtgggc
tcgctcttcgacgacccagaaaacctgcagaagaactggcttcgggaattttaccaggtc
gtgcacacacacaagccgcacttcatggccttgcactgtcaggagtttggagggaagaac
tacgaggcctccatgtcccacgtggacaagttcgtcaaagaactattgtcgagtgatgcg
atgaaagaatataacagggctcgagtctacctggatgaaaactacaaatcccaggagcac
ttcacggcactaggaagcttttattttcttcatgagtccttaaaaaacatctaccagttt
gactttaaagctaagaagtatagaaaggtcgctggcaaagagatctactcggatacctta
gagagcacgcccatgctggagaaggagaagtttccgcaggactacttccccgagtgcaaa
tggtcaagaaaaggcttcatccggacgaggtggtgcattgcagactgtgcctttgacttg
gtgaatatccatcttttccatgatgcttccaatctggtcgcctgggaaacaagcccttcc
gtgtactcgggaatccggcacaaggcactgggctacgtgctggacagaatcattgatcag
cgattcgagaaggtttcctactttgtatttggtgatttcaacttccggctggattccaag
tccgtcgtggagacgctctgcacaaaagccaccatgcagacggtccgggccgccgacacc
aatgaagtggtgaagctcatatttcgtgagtcggacaacgaccggaaggttatgctccag
ttagaaaagaaactcttcgactacttcaaccaggaggttttccgagacaacaacggcacc
gcgctcttggagtttgacaaggagttgtctgtctttaaggacagactgtatgaactggac
atctcgttccctcccagctacccgtacagtgaggacgcccgccagggtgagcagtacatg
aacacccggtgcccagcctggtgtgaccgcatcctcatgtccccgtctgccaaggagctg
gtgctgcggtcggagagcgaggagaaggttgtcacctatgaccacattgggcccaacgtc
tgcatgggagaccacaagcccgtgttcctggccttccgaatcatgcccggggcaggtaaa
cctcatgcccatgtgcacaagtgttgtgtcgtgcagtga

DBGET integrated database retrieval system