KEGG   Homo sapiens (human): 3645Help
Entry
3645              CDS       T01001                                 

Gene name
INSRR, IRR
Definition
(RefSeq) insulin receptor related receptor
  KO
K05086  insulin receptor-related receptor [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
hsa05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3645 (INSRR)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    3645 (INSRR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    3645 (INSRR)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     3645 (INSRR)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   3645 (INSRR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like
Motif
Other DBs
NCBI-GeneID: 3645
NCBI-ProteinID: NP_055030
OMIM: 147671
HGNC: 6093
Ensembl: ENSG00000027644
Vega: OTTHUMG00000041291
Pharos: P14616(Tchem)
UniProt: P14616
Position
1q23.1
AA seq 1297 aa AA seqDB search
MAVPSLWPWGACLPVIFLSLGFGLDTVEVCPSLDIRSEVAELRQLENCSVVEGHLQILLM
FTATGEDFRGLSFPRLTQVTDYLLLFRVYGLESLRDLFPNLAVIRGTRLFLGYALVIFEM
PHLRDVALPALGAVLRGAVRVEKNQELCHLSTIDWGLLQPAPGANHIVGNKLGEECADVC
PGVLGAAGEPCAKTTFSGHTDYRCWTSSHCQRVCPCPHGMACTARGECCHTECLGGCSQP
EDPRACVACRHLYFQGACLWACPPGTYQYESWRCVTAERCASLHSVPGRASTFGIHQGSC
LAQCPSGFTRNSSSIFCHKCEGLCPKECKVGTKTIDSIQAAQDLVGCTHVEGSLILNLRQ
GYNLEPQLQHSLGLVETITGFLKIKHSFALVSLGFFKNLKLIRGDAMVDGNYTLYVLDNQ
NLQQLGSWVAAGLTIPVGKIYFAFNPRLCLEHIYRLEEVTGTRGRQNKAEINPRTNGDRA
ACQTRTLRFVSNVTEADRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHVGPDACGT
QSWNLLDVELPLSRTQEPGVTLASLKPWTQYAVFVRAITLTTEEDSPHQGAQSPIVYLRT
LPAAPTVPQDVISTSNSSSHLLVRWKPPTQRNGNLTYYLVLWQRLAEDGDLYLNDYCHRG
LRLPTSNNDPRFDGEDGDPEAEMESDCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNA
ITIPISPWKVTSINKSPQRDSGRHRRAAGPLRLGGNSSDFEIQEDKVPRERAVLSGLRHF
TEYRIDIHACNHAAHTVGCSAATFVFARTMPHREADGIPGKVAWEASSKNSVLLRWLEPP
DPNGLILKYEIKYRRLGEEATVLCVSRLRYAKFGGVHLALLPPGNYSARVRATSLAGNGS
WTDSVAFYILGPEEEDAGGLHVLLTATPVGLTLLIVLAALGFFYGKKRNRTLYASVNPEY
FSASDMYVPDEWEVPREQISIIRELGQGSFGMVYEGLARGLEAGEESTPVALKTVNELAS
PRECIEFLKEASVMKAFKCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSHLRSLRPEAEN
NPGLPQPALGEMIQMAGEIADGMAYLAANKFVHRDLAARNCMVSQDFTVKIGDFGMTRDV
YETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQ
VLKFVMDGGVLEELEGCPLQLQELMSRCWQPNPRLRPSFTHILDSIQEELRPSFRLLSFY
YSPECRGARGSLPTTDAEPDSSPTPRDCSPQNGGPGH
NT seq 3894 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgcctagtctgtggccctggggagcatgcctgcctgtgatcttcctctccttg
ggatttggcctggatacagtagaggtgtgccccagcctggatattcgctcagaggtggca
gagcttcgtcagctggagaactgcagcgtggtggagggccacctgcagatcctgctcatg
ttcacagccaccggggaggacttccgcggcctcagcttccctcgcctcacccaggtcacc
gactacctgctgctcttccgtgtctacggactggagagcctgcgcgacctcttccccaac
ctagcagtcatccgcgggacgcgcctcttcctgggctatgcactggtcatctttgagatg
ccacatctgcgtgacgtggcactgcctgcacttggggccgtgctgcgtggggctgtgcgt
gtggagaagaaccaggagctctgccacctctccaccattgactggggactgctgcagcca
gcacctggcgccaaccacatcgtgggcaacaagctgggcgaggagtgtgctgacgtgtgc
cctggtgtgctgggtgctgctggtgagccctgtgccaagaccaccttcagcgggcacact
gactacagatgctggacctccagccactgccagagagtgtgcccctgcccccatgggatg
gcttgcacagcgaggggcgagtgctgccacaccgaatgcctggggggctgcagccagcca
gaagaccctcgtgcctgtgtagcttgccgccacctctacttccagggtgcctgcctgtgg
gcctgcccgccaggcacctaccagtatgagtcctggcgctgtgtcacagctgagcgctgt
gccagcctgcactctgtgcccggccgtgcctccaccttcggcatacaccagggcagttgc
ctggcccagtgcccttctggcttcacccgtaatagcagcagcatattctgccacaagtgc
gaggggctgtgccctaaagagtgcaaggtaggcaccaagaccatcgactccatccaggcg
gcacaggatcttgtgggctgcacgcatgtggagggaagcctcatcctcaaccttcgccag
ggctacaacctggagccacagctgcagcacagcctggggctggtagaaaccattactggc
ttcctcaaaatcaagcactcctttgccctcgtgtccctgggctttttcaagaacctcaaa
ctaatccggggagacgccatggtggatgggaactacactctctacgtgctggacaaccag
aacctacaacagctagggtcctgggtggccgcggggctcaccattcccgtgggcaagatc
tacttcgccttcaacccgcgcctctgcttggaacacatctaccgactggaggaggtgaca
ggcacgcgaggtcggcagaacaaggctgagatcaacccccgcaccaacggagaccgcgcc
gcctgccagactcgcaccctgcgcttcgtgtccaacgtgacggaggcagaccgcatcctg
ctacgctgggagcgctatgagccactggaggcccgcgacctgctcagcttcatcgtgtac
tacaaggagtccccattccagaacgccacagagcacgtgggtccagatgcttgtggaacc
cagagctggaacctgctggatgtggagctgcccctaagccgcacccaggagccaggggtg
accctagcctccctcaagccttggacacagtacgcagtgtttgtgcgggccatcacgcta
accactgaggaggacagccctcatcaaggagcccagagtcccatcgtctacctccgaacg
ctgcctgcagctcccacggtgccccaagacgtcatctccacgtccaactcctcctcccac
ctcctggtgcgctggaagccaccgacccagcgcaatgggaacctcacctactacctggtg
ctgtggcagcggctggcagaggacggcgacctctacctcaatgactactgccaccgcggc
ttgcggctgcccaccagcaacaacgatccgcgcttcgacggcgaagacggggatcctgag
gccgagatggagtccgactgctgcccttgccagcacccacctcctggtcaggttctgccc
ccgctggaggcgcaagaggcctcgttccagaagaagtttgaaaactttctacacaacgcg
atcaccatccccatatccccttggaaggtgacgtccatcaacaagagcccccaaagggac
tcagggcggcaccgccgggcagctgggcccctccggctggggggcaacagctcggatttc
gagatccaggaggacaaggtgccccgtgagcgagcggtgctgagcggcctgcgccacttc
acggaataccggatcgacatccatgcctgcaaccacgcggcgcacaccgtgggctgcagc
gccgccaccttcgtctttgcgcgcaccatgccccacagagaggctgatggtattccagga
aaggtggcctgggaggcctccagcaagaacagtgtccttctgcgctggctcgagccacca
gaccccaacggactcatcctcaagtacgaaatcaagtaccgccgcttgggagaggaggcc
acagtgctgtgtgtgtcccgtcttcgatatgcgaagtttgggggagtccacctggccctg
ctgccccctggaaactactctgccagggttagggcaacctcactggctggcaatggctct
tggacagacagtgttgccttctacatccttggcccagaggaggaggatgctggggggctg
catgtcctcctcactgccacccctgtggggctcacgctgctcatcgttcttgctgccctt
ggtttcttctacggcaagaagagaaacagaaccctgtatgcttctgtgaatccagagtac
ttcagcgcctctgatatgtatgtccctgatgaatgggaggtgcctcgggagcagatctcg
ataatccgggaactgggccagggctcttttgggatggtatatgaggggctggcacgagga
cttgaggctggagaggagtccacacccgtggccctgaagacggtgaatgagctggccagc
ccacgggaatgcattgagttcctcaaggaagcttctgtcatgaaagccttcaagtgtcac
catgtggtgcgtctcctgggtgtggtatctcagggccagccaactctggtcatcatggag
ttaatgacccgtggggacctcaagagccatcttcgatctttgcggcctgaggcagagaac
aaccctgggctcccacagccagcattgggggaaatgatccaaatggctggtgagattgca
gacggcatggcctaccttgctgccaacaagtttgtgcaccgagatctagcagcccgcaac
tgcatggtgtcccaggacttcaccgtcaagatcggggacttcgggatgactcgggacgtg
tatgagacagactattaccgcaagggtgggaaggggctgctgcccgtgcgctggatggcc
cccgagtccctcaaagatgggatcttcaccacccactcggatgtctggtcctttggcgtg
gtactctgggagattgtgaccctggcagaacaaccctaccagggcctgtccaatgagcag
gtgctgaagttcgtcatggatggcggggtcctggaggagctggagggctgtccccttcag
ctgcaggagctgatgagccgctgctggcagccgaacccacgcctgcgcccatctttcaca
cacattctggacagcatacaggaggagctgcggccctccttccgcctcctctccttctac
tacagcccggaatgccggggggcccggggctccctgcctaccaccgatgcagagcctgac
tcctcacccactccaagagactgcagccctcaaaatgggggtccagggcactga

DBGET integrated database retrieval system