KEGG   Homo sapiens (human): 3654
Entry
3654              CDS       T01001                                 

Gene name
IRAK1, IRAK, pelle
Definition
(RefSeq) interleukin 1 receptor associated kinase 1
  KO
K04730  interleukin-1 receptor-associated kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05417  Lipid and atherosclerosis
Network
nt06110  MAPK signaling (viruses and bacteria)
nt06121  TLR signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06211  Other MAPK signaling
nt06263  Hepatocellular carcinoma
  Element
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3654 (IRAK1)
   04064 NF-kappa B signaling pathway
    3654 (IRAK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3654 (IRAK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    3654 (IRAK1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3654 (IRAK1)
   05161 Hepatitis B
    3654 (IRAK1)
   05171 Coronavirus disease - COVID-19
    3654 (IRAK1)
   05162 Measles
    3654 (IRAK1)
   05168 Herpes simplex virus 1 infection
    3654 (IRAK1)
   05169 Epstein-Barr virus infection
    3654 (IRAK1)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    3654 (IRAK1)
   05132 Salmonella infection
    3654 (IRAK1)
   05135 Yersinia infection
    3654 (IRAK1)
   05133 Pertussis
    3654 (IRAK1)
   05152 Tuberculosis
    3654 (IRAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3654 (IRAK1)
   05140 Leishmaniasis
    3654 (IRAK1)
   05142 Chagas disease
    3654 (IRAK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3654 (IRAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    3654 (IRAK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     3654 (IRAK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  IRAK family
   3654 (IRAK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Death APH RAMP
Other DBs
NCBI-GeneID: 3654
NCBI-ProteinID: NP_001560
OMIM: 300283
HGNC: 6112
Ensembl: ENSG00000184216
Vega: OTTHUMG00000024228
Pharos: P51617(Tchem)
UniProt: P51617
Structure
PDB: 
6BFN

Position
Xq28
AA seq 712 aa
MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE
RSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSS
IPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTK
PGPESSVSLLQGARPFPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKR
LKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRL
HCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFG
LARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAG
QRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDP
RPGPCPPELGLGLGQLACCCLHRRAKRRPPMTQVYERLEKLQAVVAGVPGHSEAASCIPP
SPQENSYVSSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALR
SWHLTPSCPLDPAPLREAGCPQGDTAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQI
IINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggccggggggccgggcccgggggagcccgcagcccccggcgcccagcacttcttgtac
gaggtgccgccctgggtcatgtgccgcttctacaaagtgatggacgccctggagcccgcc
gactggtgccagttcgccgccctgatcgtgcgcgaccagaccgagctgcggctgtgcgag
cgctccgggcagcgcacggccagcgtcctgtggccctggatcaaccgcaacgcccgtgtg
gccgacctcgtgcacatcctcacgcacctgcagctgctccgtgcgcgggacatcatcaca
gcctggcaccctcccgccccgcttccgtccccaggcaccactgccccgaggcccagcagc
atccctgcacccgccgaggccgaggcctggagcccccggaagttgccatcctcagcctcc
accttcctctccccagcttttccaggctcccagacccattcagggcctgagctcggcctg
gtcccaagccctgcttccctgtggcctccaccgccatctccagccccttcttctaccaag
ccaggcccagagagctcagtgtccctcctgcagggagcccgcccctttccgttttgctgg
cccctctgtgagatttcccggggcacccacaacttctcggaggagctcaagatcggggag
ggtggctttgggtgcgtgtaccgggcggtgatgaggaacacggtgtatgctgtgaagagg
ctgaaggagaacgctgacctggagtggactgcagtgaagcagagcttcctgaccgaggtg
gagcagctgtccaggtttcgtcacccaaacattgtggactttgctggctactgtgctcag
aacggcttctactgcctggtgtacggcttcctgcccaacggctccctggaggaccgtctc
cactgccagacccaggcctgcccacctctctcctggcctcagcgactggacatccttctg
ggtacagcccgggcaattcagtttctacatcaggacagccccagcctcatccatggagac
atcaagagttccaacgtccttctggatgagaggctgacacccaagctgggagactttggc
ctggcccggttcagccgctttgccgggtccagccccagccagagcagcatggtggcccgg
acacagacagtgcggggcaccctggcctacctgcccgaggagtacatcaagacgggaagg
ctggctgtggacacggacaccttcagctttggggtggtagtgctagagaccttggctggt
cagagggctgtgaagacgcacggtgccaggaccaagtatctgaaagacctggtggaagag
gaggctgaggaggctggagtggctttgagaagcacccagagcacactgcaagcaggtctg
gctgcagatgcctgggctgctcccatcgccatgcagatctacaagaagcacctggacccc
aggcccgggccctgcccacctgagctgggcctgggcctgggccagctggcctgctgctgc
ctgcaccgccgggccaaaaggaggcctcctatgacccaggtgtacgagaggctagagaag
ctgcaggcagtggtggcgggggtgcccgggcattcggaggccgccagctgcatcccccct
tccccgcaggagaactcctacgtgtccagcactggcagagcccacagtggggctgctcca
tggcagcccctggcagcgccatcaggagccagtgcccaggcagcagagcagctgcagaga
ggccccaaccagcccgtggagagtgacgagagcctaggcggcctctctgctgccctgcgc
tcctggcacttgactccaagctgccctctggacccagcacccctcagggaggccggctgt
cctcagggggacacggcaggagaatcgagctgggggagtggcccaggatcccggcccaca
gccgtggaaggactggcccttggcagctctgcatcatcgtcgtcagagccaccgcagatt
atcatcaaccctgcccgacagaagatggtccagaagctggccctgtacgaggatggggcc
ctggacagcctgcagctgctgtcgtccagctccctcccaggcttgggcctggaacaggac
aggcaggggcccgaagaaagtgatgaatttcagagctga

KEGG   Homo sapiens (human): 3656
Entry
3656              CDS       T01001                                 

Gene name
IRAK2, IRAK-2
Definition
(RefSeq) interleukin 1 receptor associated kinase 2
  KO
K04731  interleukin-1 receptor-associated kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04722  Neurotrophin signaling pathway
hsa05152  Tuberculosis
Disease
H01358  Atopic dermatitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    3656 (IRAK2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3656 (IRAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    3656 (IRAK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     3656 (IRAK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  IRAK family
   3656 (IRAK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Death
Other DBs
NCBI-GeneID: 3656
NCBI-ProteinID: NP_001561
OMIM: 603304
HGNC: 6113
Ensembl: ENSG00000134070
Vega: OTTHUMG00000155358
Pharos: O43187(Tbio)
UniProt: O43187
Structure
PDB: 
3MOP

Position
3p25.3
AA seq 625 aa
MACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITREL
LWWWGMRQATVQQLVDLLCRLELYRAAQIILNWKPAPEIRCPIPAFPDSVKPEKPLAASV
RKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFST
SIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKLR
ETACSSPGSIERFFQAELQICLRCCHPNVLPVLGFCAARQFHSFIYPYMANGSLQDRLQG
QGGSDPLPWPQRVSICSGLLCAVEYLHGLEIIHSNVKSSNVLLDQNLTPKLAHPMAHLCP
VNKRSKYTMMKTHLLRTSAAYLPEDFIRVGQLTKRVDIFSCGIVLAEVLTGIPAMDNNRS
PVYLKDLLLSDIPSSTASLCSRKTGVENVMAKEICQKYLEKGAGRLPEDCAEALATAACL
CLRRRNTSLQEVCGSVAAVEERLRGRETLLPWSGLSEGTGSSSNTPEETDDVDNSSLDAS
SSMSVAPWAGAATPLLPTENGEGRLRVIVGREADSSSEACVGLEPPQDVTETSWQIEINE
AKRKLMENILLYKEEKVDSIELFGP
NT seq 1878 nt   +upstreamnt  +downstreamnt
atggcctgctacatctaccagctgccctcctgggtgctggacgacctgtgccgcaacatg
gacgcgctcagcgagtgggactggatggagttcgcctcctacgtgatcacagacctgacc
cagctgcggaagatcaagtccatggagcgggtgcagggtgtgagcatcacgcgggagctg
ctgtggtggtggggcatgcggcaggccaccgtccagcaacttgtggacctcctgtgccgc
ctggagctctaccgggctgcccagatcatcctgaactggaaaccggctcctgaaatcagg
tgtcccattccagccttccctgactctgtgaagccagaaaagcctttggcagcttctgta
agaaaggctgaggatgaacaggaagaggggcagcctgtgaggatggccacctttccaggc
ccagggtcctctccagccagagcccaccagccggcctttctccagcctcctgaagaagat
gcccctcattccttgagaagcgacctccccacttcgtctgattcaaaggacttcagcacc
tccattcctaagcaggaaaaacttttgagcttggctggagacagccttttctggagtgag
gcagacgtggtccaggcaaccgatgacttcaatcaaaaccgcaaaatcagccaggggacc
tttgctgacgtctacagagggcacaggcacgggaagccattcgtcttcaagaagctcaga
gagacagcctgttcaagtccaggatcaatcgaaagattcttccaggcagagttgcagatt
tgtcttagatgctgccaccccaatgtcttacctgtgctgggcttctgtgctgcaagacag
tttcacagcttcatctacccctacatggcaaatggttccctacaggacagactgcagggt
cagggtggctcggaccccctcccctggccccagcgtgtcagcatctgctcagggctgctc
tgtgccgtcgagtacctgcatggtctggagatcatccacagcaacgtcaagagctctaat
gtcttgctggaccaaaatctcacccccaaacttgctcacccaatggctcatctgtgtcct
gtcaacaaaaggtcaaaatacaccatgatgaagactcacctgctccggacgtcagccgcg
tatctgccagaggatttcatccgggtggggcagctgacaaagcgagtggacatcttcagc
tgtggaatagtgttggccgaggtcctcacgggcatccctgcaatggataacaaccgaagc
ccggtttacctgaaggacttactcctcagtgatattccaagcagcaccgcctcgctctgc
tccaggaagacgggcgtggagaacgtgatggcaaaggagatctgccagaagtacctggag
aagggcgcagggaggcttccggaggactgcgccgaggccctggccacggctgcctgcctg
tgcctgcggaggcgtaacaccagcctgcaggaggtgtgtggctctgtggctgctgtggaa
gagcggctccgaggtcgggagacgttgctcccttggagtgggctttctgagggtacaggc
tcttcttccaacaccccagaggaaacagacgacgttgacaattccagccttgatgcctcc
tcctccatgagtgtggcaccctgggcaggggctgccaccccacttctccccacagagaat
ggggaaggaaggctgcgggtcatcgtgggaagggaggctgactcctcctctgaggcctgt
gttggcctggagcctccccaggatgttacagaaacttcgtggcaaattgagatcaatgag
gccaaaaggaaactgatggagaatattctgctctacaaagaggaaaaagtggacagcatt
gagctctttggcccctga

DBGET integrated database retrieval system