KEGG   Homo sapiens (human): 3654Help
Entry
3654              CDS       T01001                                 

Gene name
IRAK1, IRAK, pelle
Definition
(RefSeq) interleukin 1 receptor associated kinase 1
  KO
K04730  interleukin-1 receptor-associated kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa05133  Pertussis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05162  Measles
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
Module
hsa_M00686  Toll-like receptor signaling
Network
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00265  EBV LMP1 to host-cell-protein activation
N00435  TLR2/4-NFKB signaling pathway
N00438  TLR2/4-MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3654 (IRAK1)
   04064 NF-kappa B signaling pathway
    3654 (IRAK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3654 (IRAK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    3654 (IRAK1)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05133 Pertussis
    3654 (IRAK1)
   05152 Tuberculosis
    3654 (IRAK1)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    3654 (IRAK1)
   05162 Measles
    3654 (IRAK1)
   05169 Epstein-Barr virus infection
    3654 (IRAK1)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    3654 (IRAK1)
   05140 Leishmaniasis
    3654 (IRAK1)
   05142 Chagas disease (American trypanosomiasis)
    3654 (IRAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    3654 (IRAK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     3654 (IRAK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  IRAK family
   3654 (IRAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Death APH RAMP
Motif
Other DBs
NCBI-GeneID: 3654
NCBI-ProteinID: NP_001560
OMIM: 300283
HGNC: 6112
Ensembl: ENSG00000184216
Vega: OTTHUMG00000024228
Pharos: P51617(Tchem)
UniProt: P51617
Structure
PDB: 

Position
Xq28
AA seq 712 aa AA seqDB search
MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE
RSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSS
IPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTK
PGPESSVSLLQGARPFPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKR
LKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRL
HCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFG
LARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAG
QRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDP
RPGPCPPELGLGLGQLACCCLHRRAKRRPPMTQVYERLEKLQAVVAGVPGHSEAASCIPP
SPQENSYVSSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALR
SWHLTPSCPLDPAPLREAGCPQGDTAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQI
IINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atggccggggggccgggcccgggggagcccgcagcccccggcgcccagcacttcttgtac
gaggtgccgccctgggtcatgtgccgcttctacaaagtgatggacgccctggagcccgcc
gactggtgccagttcgccgccctgatcgtgcgcgaccagaccgagctgcggctgtgcgag
cgctccgggcagcgcacggccagcgtcctgtggccctggatcaaccgcaacgcccgtgtg
gccgacctcgtgcacatcctcacgcacctgcagctgctccgtgcgcgggacatcatcaca
gcctggcaccctcccgccccgcttccgtccccaggcaccactgccccgaggcccagcagc
atccctgcacccgccgaggccgaggcctggagcccccggaagttgccatcctcagcctcc
accttcctctccccagcttttccaggctcccagacccattcagggcctgagctcggcctg
gtcccaagccctgcttccctgtggcctccaccgccatctccagccccttcttctaccaag
ccaggcccagagagctcagtgtccctcctgcagggagcccgcccctttccgttttgctgg
cccctctgtgagatttcccggggcacccacaacttctcggaggagctcaagatcggggag
ggtggctttgggtgcgtgtaccgggcggtgatgaggaacacggtgtatgctgtgaagagg
ctgaaggagaacgctgacctggagtggactgcagtgaagcagagcttcctgaccgaggtg
gagcagctgtccaggtttcgtcacccaaacattgtggactttgctggctactgtgctcag
aacggcttctactgcctggtgtacggcttcctgcccaacggctccctggaggaccgtctc
cactgccagacccaggcctgcccacctctctcctggcctcagcgactggacatccttctg
ggtacagcccgggcaattcagtttctacatcaggacagccccagcctcatccatggagac
atcaagagttccaacgtccttctggatgagaggctgacacccaagctgggagactttggc
ctggcccggttcagccgctttgccgggtccagccccagccagagcagcatggtggcccgg
acacagacagtgcggggcaccctggcctacctgcccgaggagtacatcaagacgggaagg
ctggctgtggacacggacaccttcagctttggggtggtagtgctagagaccttggctggt
cagagggctgtgaagacgcacggtgccaggaccaagtatctgaaagacctggtggaagag
gaggctgaggaggctggagtggctttgagaagcacccagagcacactgcaagcaggtctg
gctgcagatgcctgggctgctcccatcgccatgcagatctacaagaagcacctggacccc
aggcccgggccctgcccacctgagctgggcctgggcctgggccagctggcctgctgctgc
ctgcaccgccgggccaaaaggaggcctcctatgacccaggtgtacgagaggctagagaag
ctgcaggcagtggtggcgggggtgcccgggcattcggaggccgccagctgcatcccccct
tccccgcaggagaactcctacgtgtccagcactggcagagcccacagtggggctgctcca
tggcagcccctggcagcgccatcaggagccagtgcccaggcagcagagcagctgcagaga
ggccccaaccagcccgtggagagtgacgagagcctaggcggcctctctgctgccctgcgc
tcctggcacttgactccaagctgccctctggacccagcacccctcagggaggccggctgt
cctcagggggacacggcaggagaatcgagctgggggagtggcccaggatcccggcccaca
gccgtggaaggactggcccttggcagctctgcatcatcgtcgtcagagccaccgcagatt
atcatcaaccctgcccgacagaagatggtccagaagctggccctgtacgaggatggggcc
ctggacagcctgcagctgctgtcgtccagctccctcccaggcttgggcctggaacaggac
aggcaggggcccgaagaaagtgatgaatttcagagctga

KEGG   Homo sapiens (human): 51135Help
Entry
51135             CDS       T01001                                 

Gene name
IRAK4, IPD1, IRAK-4, NY-REN-64, REN64
Definition
(RefSeq) interleukin 1 receptor associated kinase 4
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa05133  Pertussis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05162  Measles
hsa05164  Influenza A
hsa05170  Human immunodeficiency virus 1 infection
Module
hsa_M00686  Toll-like receptor signaling
Network
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00438  TLR2/4-MAPK signaling pathway
Disease
H00096  Defects of toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    51135 (IRAK4)
   04064 NF-kappa B signaling pathway
    51135 (IRAK4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    51135 (IRAK4)
   04621 NOD-like receptor signaling pathway
    51135 (IRAK4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    51135 (IRAK4)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05133 Pertussis
    51135 (IRAK4)
   05152 Tuberculosis
    51135 (IRAK4)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    51135 (IRAK4)
   05162 Measles
    51135 (IRAK4)
   05164 Influenza A
    51135 (IRAK4)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    51135 (IRAK4)
   05140 Leishmaniasis
    51135 (IRAK4)
   05142 Chagas disease (American trypanosomiasis)
    51135 (IRAK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    51135 (IRAK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     51135 (IRAK4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  IRAK family
   51135 (IRAK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Haspin_kinase Death
Motif
Other DBs
NCBI-GeneID: 51135
NCBI-ProteinID: NP_001107654
OMIM: 606883
HGNC: 17967
Ensembl: ENSG00000198001
Vega: OTTHUMG00000169425
Pharos: Q9NWZ3(Tchem)
UniProt: Q9NWZ3 Q69FE3 B4E359
Structure
PDB: 

Position
12q12
AA seq 460 aa AA seqDB search
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITV
QQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNF
DERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGIN
FLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND
ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacccataacaccatcaacatatgtgcgctgcctcaatgttggactaattagg
aagctgtcagattttattgatcctcaagaaggatggaagaagttagctgtagctattaaa
aaaccatctggtgatgatagatacaatcagtttcacataaggagatttgaagcattactt
caaactggaaaaagtcccacttctgaattactgtttgactggggcaccacaaattgcaca
gttggtgatcttgtggatcttttgatccaaaatgaattttttgctcctgcgagtcttttg
ctcccagatgctgttcccaaaactgctaatacactaccttctaaagaagctataacagtt
cagcaaaaacagatgcctttctgtgacaaagacaggacattgatgacacctgtgcagaat
cttgaacaaagctatatgccacctgactcctcaagtccagaaaataaaagtttagaagtt
agtgatacacgttttcacagtttttcattttatgaattgaagaatgtcacaaataacttt
gatgaacgacccatttctgttggtggtaataaaatgggagagggaggatttggagttgta
tataaaggctacgtaaataacacaactgtggcagtgaagaagcttgcagcaatggttgac
attactactgaagaactgaaacagcagtttgatcaagaaataaaagtaatggcaaagtgt
caacatgaaaacttagtagaactacttggtttctcaagtgatggagatgacctctgctta
gtatatgtttacatgcctaatggttcattgctagacagactctcttgcttggatggtact
ccaccactttcttggcacatgagatgcaagattgctcagggtgcagctaatggcatcaat
tttctacatgaaaatcatcatattcatagagatattaaaagtgcaaatatcttactggat
gaagcttttactgctaaaatatctgactttggccttgcacgggcttctgagaagtttgcc
cagacagtcatgactagcagaattgtgggaacaacagcttatatggcaccagaagctttg
cgtggagaaataacacccaaatctgatatttacagctttggtgtggttttactagaaata
ataactggacttccagctgtggatgaacaccgtgaacctcagttattgctagatattaaa
gaagaaattgaagatgaagaaaagacaattgaagattatattgataaaaagatgaatgat
gctgattccacttcagttgaagctatgtactctgttgctagtcaatgtctgcatgaaaag
aaaaataagagaccagacattaagaaggttcaacagctgctgcaagagatgacagcttct
taa

DBGET integrated database retrieval system