KEGG   Homo sapiens (human): 3655Help
Entry
3655              CDS       T01001                                 

Gene name
ITGA6, CD49f, ITGA6B, VLA-6
Definition
(RefSeq) integrin subunit alpha 6
  KO
K06485  integrin alpha 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04514  Cell adhesion molecules (CAMs)
hsa04640  Hematopoietic cell lineage
hsa04810  Regulation of actin cytoskeleton
hsa05145  Toxoplasmosis
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Disease
H00586  Epidermolysis bullosa, junctional
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3655 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3655 (ITGA6)
   04514 Cell adhesion molecules (CAMs)
    3655 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3655 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3655 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3655 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3655 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    3655 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    3655 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3655 (ITGA6)
   05414 Dilated cardiomyopathy (DCM)
    3655 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3655 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3655 (ITGA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3655 (ITGA6)
   04515 Cell adhesion molecules [BR:hsa04515]
    3655 (ITGA6)
   04090 CD molecules [BR:hsa04090]
    3655 (ITGA6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3655 (ITGA6)
  Exosomal proteins of breast milk
   3655 (ITGA6)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3655 (ITGA6)
CD molecules [BR:hsa04090]
 Proteins
  3655 (ITGA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS LRR19-TM Integrin_alpha
Motif
Other DBs
NCBI-GeneID: 3655
NCBI-ProteinID: NP_001073286
OMIM: 147556
HGNC: 6142
Ensembl: ENSG00000091409
Vega: OTTHUMG00000132277
Pharos: P23229(Tbio)
UniProt: P23229
Position
2q31.1
AA seq 1091 aa AA seqDB search
MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETEHDESLVPVPANSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSAH
LLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYMNQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDLGKVFIYHGSANGINTK
PTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNR
IDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFR
NQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSL
PEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKG
VPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSNVTFYLVLSTTEVTFDTPDLDINLKLETTSNQD
NLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLG
KPLTNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKVTCEPQKEINSLNLTESHNSRK
KREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNST
FLEEYSKLNYLDILMRAFIDVTAAAENIRLPNAGTQVRVTVFPSKTVAQYSGVPWWIILV
AILAGILMLALLVFILWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYIDNLEKKQW
ITKWNENESYS
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgccgggcagctgtgcttgctctacctgtcggcggggctcctgtcccggctc
ggcgcagccttcaacttggacactcgggaggacaacgtgatccggaaatatggagacccc
gggagcctcttcggcttctcgctggccatgcactggcaactgcagcccgaggacaagcgg
ctgttgctcgtgggggccccgcgggcagaagcgcttccactgcagagagccaacagaacg
ggagggctgtacagctgcgacatcaccgcccgggggccatgcacgcggatcgagtttgat
aacgatgctgaccccacgtcagaaagcaaggaagatcagtggatgggggtcaccgtccag
agccaaggtccagggggcaaggtcgtgacatgtgctcaccgatatgaaaaaaggcagcat
gttaatacgaagcaggaatcccgagacatctttgggcggtgttatgtcctgagtcagaat
ctcaggattgaagacgatatggatgggggagattggagcttttgtgatgggcgattgaga
ggccatgagaaatttggctcttgccagcaaggtgtagcagctacttttactaaagacttt
cattacattgtatttggagccccgggtacttataactggaaagggattgttcgtgtagag
caaaagaataacactttttttgacatgaacatctttgaagatgggccttatgaagttggt
ggagagactgagcatgatgaaagtctcgttcctgttcctgctaacagttacttaggtttt
tctttggactcagggaaaggtattgtttctaaagatgagatcacttttgtatctggtgct
cccagagccaatcacagtggagccgtggttttgctgaagagagacatgaagtctgcacat
ctcctccctgagcacatattcgatggagaaggtctggcctcttcatttggctatgatgtg
gcggtggtggacctcaacaaggatgggtggcaagatatagttattggagccccacagtat
tttgatagagatggagaagttggaggtgcagtgtatgtctacatgaaccagcaaggcaga
tggaataatgtgaagccaattcgtcttaatggaaccaaagattctatgtttggcattgca
gtaaaaaatattggagatattaatcaagatggctacccagatattgcagttggagctccg
tatgatgacttgggaaaggtttttatctatcatggatctgcaaatggaataaataccaaa
ccaacacaggttctcaagggtatatcaccttattttggatattcaattgctggaaacatg
gaccttgatcgaaattcctaccctgatgttgctgttggttccctctcagattcagtaact
attttcagatcccggcctgtgattaatattcagaaaaccatcacagtaactcctaacaga
attgacctccgccagaaaacagcgtgtggggcgcctagtgggatatgcctccaggttaaa
tcctgttttgaatatactgctaaccccgctggttataatccttcaatatcaattgtgggc
acacttgaagctgaaaaagaaagaagaaaatctgggctatcctcaagagttcagtttcga
aaccaaggttctgagcccaaatatactcaagaactaactctgaagaggcagaaacagaaa
gtgtgcatggaggaaaccctgtggctacaggataatatcagagataaactgcgtcccatt
cccataactgcctcagtggagatccaagagccaagctctcgtaggcgagtgaattcactt
ccagaagttcttccaattctgaattcagatgaacccaagacagctcatattgatgttcac
ttcttaaaagagggatgtggagacgacaatgtatgtaacagcaaccttaaactagaatat
aaattttgcacccgagaaggaaatcaagacaaattttcttatttaccaattcaaaaaggt
gtaccagaactagttctaaaagatcagaaggatattgctttagaaataacagtgacaaac
agcccttccaacccaaggaatcccacaaaagatggcgatgacgcccatgaggctaaactg
attgcaacgtttccagacactttaacctattctgcatatagagaactgagggctttccct
gagaaacagttgagttgtgttgccaaccagaatggctcgcaagctgactgtgagctcgga
aatccttttaaaagaaattcaaatgtcactttttatttggttttaagtacaactgaagtc
acctttgacaccccagatctggatattaatctgaagttagaaacaacaagcaatcaagat
aatttggctccaattacagctaaagcaaaagtggttattgaactgcttttatcggtctcg
ggagttgctaaaccttcccaggtgtattttggaggtacagttgttggcgagcaagctatg
aaatctgaagatgaagtgggaagtttaatagagtatgaattcagggtaataaacttaggt
aaacctcttacaaacctcggcacagcaaccttgaacattcagtggccaaaagaaattagc
aatgggaaatggttgctttatttggtgaaagtagaatccaaaggattggaaaaggtaact
tgtgagccacaaaaggagataaactccctgaacctaacggagtctcacaactcaagaaag
aaacgggaaattactgaaaaacagatagatgataacagaaaattttctttatttgctgaa
agaaaataccagactcttaactgtagcgtgaacgtgaactgtgtgaacatcagatgcccg
ctgcgggggctggacagcaaggcgtctcttattttgcgctcgaggttatggaacagcaca
tttctagaggaatattccaaactgaactacttggacattctcatgcgagccttcattgat
gtgactgctgctgccgaaaatatcaggctgccaaatgcaggcactcaggttcgagtgact
gtgtttccctcaaagactgtagctcagtattcgggagtaccttggtggatcatcctagtg
gctattctcgctgggatcttgatgcttgctttattagtgtttatactatggaagtgtgga
ttctttaaacgctctaggtacgatgacagtgttccccgataccatgctgtaaggatccgg
aaagaagagcgagagatcaaagatgaaaagtatattgataaccttgaaaaaaaacagtgg
atcacaaagtggaacgaaaatgaaagctactcatag

DBGET integrated database retrieval system