KEGG   Homo sapiens (human): 3655Help
Entry
3655              CDS       T01001                                 

Gene name
ITGA6, CD49f, ITGA6B, VLA-6
Definition
(RefSeq) integrin subunit alpha 6
  KO
K06485  integrin alpha 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04514  Cell adhesion molecules (CAMs)
hsa04640  Hematopoietic cell lineage
hsa04810  Regulation of actin cytoskeleton
hsa05145  Toxoplasmosis
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Disease
H00586  Epidermolysis bullosa, junctional
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3655 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3655 (ITGA6)
   04514 Cell adhesion molecules (CAMs)
    3655 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3655 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3655 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3655 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3655 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    3655 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    3655 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3655 (ITGA6)
   05414 Dilated cardiomyopathy (DCM)
    3655 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3655 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3655 (ITGA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3655 (ITGA6)
   04515 Cell adhesion molecules [BR:hsa04515]
    3655 (ITGA6)
   04090 CD molecules [BR:hsa04090]
    3655 (ITGA6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3655 (ITGA6)
  Exosomal proteins of breast milk
   3655 (ITGA6)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3655 (ITGA6)
CD molecules [BR:hsa04090]
 Proteins
  3655 (ITGA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS LRR19-TM Integrin_alpha
Motif
Other DBs
NCBI-GeneID: 3655
NCBI-ProteinID: NP_001073286
OMIM: 147556
HGNC: 6142
Ensembl: ENSG00000091409
Vega: OTTHUMG00000132277
Pharos: P23229(Tbio)
UniProt: P23229
Position
2q31.1
AA seq 1091 aa AA seqDB search
MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETEHDESLVPVPANSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSAH
LLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYMNQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDLGKVFIYHGSANGINTK
PTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNR
IDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFR
NQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSL
PEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKG
VPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSNVTFYLVLSTTEVTFDTPDLDINLKLETTSNQD
NLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLG
KPLTNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKVTCEPQKEINSLNLTESHNSRK
KREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNST
FLEEYSKLNYLDILMRAFIDVTAAAENIRLPNAGTQVRVTVFPSKTVAQYSGVPWWIILV
AILAGILMLALLVFILWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYIDNLEKKQW
ITKWNENESYS
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgccgggcagctgtgcttgctctacctgtcggcggggctcctgtcccggctc
ggcgcagccttcaacttggacactcgggaggacaacgtgatccggaaatatggagacccc
gggagcctcttcggcttctcgctggccatgcactggcaactgcagcccgaggacaagcgg
ctgttgctcgtgggggccccgcgggcagaagcgcttccactgcagagagccaacagaacg
ggagggctgtacagctgcgacatcaccgcccgggggccatgcacgcggatcgagtttgat
aacgatgctgaccccacgtcagaaagcaaggaagatcagtggatgggggtcaccgtccag
agccaaggtccagggggcaaggtcgtgacatgtgctcaccgatatgaaaaaaggcagcat
gttaatacgaagcaggaatcccgagacatctttgggcggtgttatgtcctgagtcagaat
ctcaggattgaagacgatatggatgggggagattggagcttttgtgatgggcgattgaga
ggccatgagaaatttggctcttgccagcaaggtgtagcagctacttttactaaagacttt
cattacattgtatttggagccccgggtacttataactggaaagggattgttcgtgtagag
caaaagaataacactttttttgacatgaacatctttgaagatgggccttatgaagttggt
ggagagactgagcatgatgaaagtctcgttcctgttcctgctaacagttacttaggtttt
tctttggactcagggaaaggtattgtttctaaagatgagatcacttttgtatctggtgct
cccagagccaatcacagtggagccgtggttttgctgaagagagacatgaagtctgcacat
ctcctccctgagcacatattcgatggagaaggtctggcctcttcatttggctatgatgtg
gcggtggtggacctcaacaaggatgggtggcaagatatagttattggagccccacagtat
tttgatagagatggagaagttggaggtgcagtgtatgtctacatgaaccagcaaggcaga
tggaataatgtgaagccaattcgtcttaatggaaccaaagattctatgtttggcattgca
gtaaaaaatattggagatattaatcaagatggctacccagatattgcagttggagctccg
tatgatgacttgggaaaggtttttatctatcatggatctgcaaatggaataaataccaaa
ccaacacaggttctcaagggtatatcaccttattttggatattcaattgctggaaacatg
gaccttgatcgaaattcctaccctgatgttgctgttggttccctctcagattcagtaact
attttcagatcccggcctgtgattaatattcagaaaaccatcacagtaactcctaacaga
attgacctccgccagaaaacagcgtgtggggcgcctagtgggatatgcctccaggttaaa
tcctgttttgaatatactgctaaccccgctggttataatccttcaatatcaattgtgggc
acacttgaagctgaaaaagaaagaagaaaatctgggctatcctcaagagttcagtttcga
aaccaaggttctgagcccaaatatactcaagaactaactctgaagaggcagaaacagaaa
gtgtgcatggaggaaaccctgtggctacaggataatatcagagataaactgcgtcccatt
cccataactgcctcagtggagatccaagagccaagctctcgtaggcgagtgaattcactt
ccagaagttcttccaattctgaattcagatgaacccaagacagctcatattgatgttcac
ttcttaaaagagggatgtggagacgacaatgtatgtaacagcaaccttaaactagaatat
aaattttgcacccgagaaggaaatcaagacaaattttcttatttaccaattcaaaaaggt
gtaccagaactagttctaaaagatcagaaggatattgctttagaaataacagtgacaaac
agcccttccaacccaaggaatcccacaaaagatggcgatgacgcccatgaggctaaactg
attgcaacgtttccagacactttaacctattctgcatatagagaactgagggctttccct
gagaaacagttgagttgtgttgccaaccagaatggctcgcaagctgactgtgagctcgga
aatccttttaaaagaaattcaaatgtcactttttatttggttttaagtacaactgaagtc
acctttgacaccccagatctggatattaatctgaagttagaaacaacaagcaatcaagat
aatttggctccaattacagctaaagcaaaagtggttattgaactgcttttatcggtctcg
ggagttgctaaaccttcccaggtgtattttggaggtacagttgttggcgagcaagctatg
aaatctgaagatgaagtgggaagtttaatagagtatgaattcagggtaataaacttaggt
aaacctcttacaaacctcggcacagcaaccttgaacattcagtggccaaaagaaattagc
aatgggaaatggttgctttatttggtgaaagtagaatccaaaggattggaaaaggtaact
tgtgagccacaaaaggagataaactccctgaacctaacggagtctcacaactcaagaaag
aaacgggaaattactgaaaaacagatagatgataacagaaaattttctttatttgctgaa
agaaaataccagactcttaactgtagcgtgaacgtgaactgtgtgaacatcagatgcccg
ctgcgggggctggacagcaaggcgtctcttattttgcgctcgaggttatggaacagcaca
tttctagaggaatattccaaactgaactacttggacattctcatgcgagccttcattgat
gtgactgctgctgccgaaaatatcaggctgccaaatgcaggcactcaggttcgagtgact
gtgtttccctcaaagactgtagctcagtattcgggagtaccttggtggatcatcctagtg
gctattctcgctgggatcttgatgcttgctttattagtgtttatactatggaagtgtgga
ttctttaaacgctctaggtacgatgacagtgttccccgataccatgctgtaaggatccgg
aaagaagagcgagagatcaaagatgaaaagtatattgataaccttgaaaaaaaacagtgg
atcacaaagtggaacgaaaatgaaagctactcatag

KEGG   Homo sapiens (human): 3673Help
Entry
3673              CDS       T01001                                 

Gene name
ITGA2, BR, CD49B, GPIa, HPA-5, VLA-2, VLAA2
Definition
(RefSeq) integrin subunit alpha 2
  KO
K06481  integrin alpha 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04611  Platelet activation
hsa04640  Hematopoietic cell lineage
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05222  Small cell lung cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06135  Cytoskeletal regulation (virus)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoA signaling pathway
Disease
H01235  Bleeding disorder platelet-type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3673 (ITGA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3673 (ITGA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3673 (ITGA2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3673 (ITGA2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3673 (ITGA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3673 (ITGA2)
   04611 Platelet activation
    3673 (ITGA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3673 (ITGA2)
   05205 Proteoglycans in cancer
    3673 (ITGA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    3673 (ITGA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    3673 (ITGA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3673 (ITGA2)
   05414 Dilated cardiomyopathy (DCM)
    3673 (ITGA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3673 (ITGA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3673 (ITGA2)
   04515 Cell adhesion molecules [BR:hsa04515]
    3673 (ITGA2)
   04090 CD molecules [BR:hsa04090]
    3673 (ITGA2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   3673 (ITGA2)
  Exosomal proteins of bladder cancer cells
   3673 (ITGA2)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3673 (ITGA2)
CD molecules [BR:hsa04090]
 Proteins
  3673 (ITGA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS Integrin_alpha HisK_sensor
Motif
Other DBs
NCBI-GeneID: 3673
NCBI-ProteinID: NP_002194
OMIM: 192974
HGNC: 6137
Ensembl: ENSG00000164171
Vega: OTTHUMG00000131165
Pharos: P17301(Tbio)
UniProt: P17301
Structure
PDB: 

Position
5q11.2
AA seq 1181 aa AA seqDB search
MGPERTGAAPLPLLLVLALSQGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKG
NWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLILT
RNMGTGGFLTCGPLWAQQCGNQYYTTGVCSDISPDFQLSASFSPATQPCPSLIDVVVVCD
ESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNLNTYKTKEEMIVATS
QTSQYGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCN
HDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQ
IFSIEGTVQGGDNFQMEMSQVGFSADYSSQNDILMLGAVGAFGWSGTIVQKTSHGHLIFP
KQAFDQILQDRNHSSYLGYSVAAISTGESTHFVAGAPRANYTGQIVLYSVNENGNITVIQ
AHRGDQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMSDLKKEEGRVYLFTIKEGILGQH
QFLEGPEGIENTRFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHQGTIRTKY
SQKILGSDGAFRSHLQYFGRSLDGYGDLNGDSITDVSIGAFGQVVQLWSQSIADVAIEAS
FTPEKITLVNKNAQIILKLCFSAKFRPTKQNNQVAIVYNITLDADGFSSRVTSRGLFKEN
NERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETAKV
FSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTG
IVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQ
NLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSI
VHSFEDVGPKFIFSLKVTTGSVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCN
ADINPLKIGQTSSSVSFKSENFRHTKELNCRTASCSNVTCWLKDVHMKGEYFVNVTTRIW
NGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIIGSII
AGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS
NT seq 3546 nt NT seq  +upstreamnt  +downstreamnt
atggggccagaacggacaggggccgcgccgctgccgctgctgctggtgttagcgctcagt
caaggcattttaaattgttgtttggcctacaatgttggtctcccagaagcaaaaatattt
tccggtccttcaagtgaacagtttggctatgcagtgcagcagtttataaatccaaaaggc
aactggttactggttggttcaccctggagtggctttcctgagaaccgaatgggagatgtg
tataaatgtcctgttgacctatccactgccacatgtgaaaaactaaatttgcaaacttca
acaagcattccaaatgttactgagatgaaaaccaacatgagcctcggcttgatcctcacc
aggaacatgggaactggaggttttctcacatgtggtcctctgtgggcacagcaatgtggg
aatcagtattacacaacgggtgtgtgttctgacatcagtcctgattttcagctctcagcc
agcttctcacctgcaactcagccctgcccttccctcatagatgttgtggttgtgtgtgat
gaatcaaatagtatttatccttgggatgcagtaaagaattttttggaaaaatttgtacaa
ggcctggatataggccccacaaagacacaggtggggttaattcagtatgccaataatcca
agagttgtgtttaacttgaacacatataaaaccaaagaagaaatgattgtagcaacatcc
cagacatcccaatatggtggggacctcacaaacacattcggagcaattcaatatgcaaga
aaatatgcttattcagcagcttctggtgggcgacgaagtgctacgaaagtaatggtagtt
gtaactgacggtgaatcacatgatggttcaatgttgaaagctgtgattgatcaatgcaac
catgacaatatactgaggtttggcatagcagttcttgggtacttaaacagaaacgccctt
gatactaaaaatttaataaaagaaataaaagcaatcgctagtattccaacagaaagatac
tttttcaatgtgtctgatgaagcagctctactagaaaaggctgggacattaggagaacaa
attttcagcattgaaggtactgttcaaggaggagacaactttcagatggaaatgtcacaa
gtgggattcagtgcagattactcttctcaaaatgatattctgatgctgggtgcagtggga
gcttttggctggagtgggaccattgtccagaagacatctcatggccatttgatctttcct
aaacaagcctttgaccaaattctgcaggacagaaatcacagttcatatttaggttactct
gtggctgcaatttctactggagaaagcactcactttgttgctggtgctcctcgggcaaat
tataccggccagatagtgctatatagtgtgaatgagaatggcaatatcacggttattcag
gctcaccgaggtgaccagattggctcctattttggtagtgtgctgtgttcagttgatgtg
gataaagacaccattacagacgtgctcttggtaggtgcaccaatgtacatgagtgaccta
aagaaagaggaaggaagagtctacctgtttactatcaaagagggcattttgggtcagcac
caatttcttgaaggccccgagggcattgaaaacactcgatttggttcagcaattgcagct
ctttcagacatcaacatggatggctttaatgatgtgattgttggttcaccactagaaaat
cagaattctggagctgtatacatttacaatggtcatcagggcactatccgcacaaagtat
tcccagaaaatcttgggatccgatggagcctttaggagccatctccagtactttgggagg
tccttggatggctatggagatttaaatggggattccatcaccgatgtgtctattggtgcc
tttggacaagtggttcaactctggtcacaaagtattgctgatgtagctatagaagcttca
ttcacaccagaaaaaatcactttggtcaacaagaatgctcagataattctcaaactctgc
ttcagtgcaaagttcagacctactaagcaaaacaatcaagtggccattgtatataacatc
acacttgatgcagatggattttcatccagagtaacctccagggggttatttaaagaaaac
aatgaaaggtgcctgcagaagaatatggtagtaaatcaagcacagagttgccccgagcac
atcatttatatacaggagccctctgatgttgtcaactctttggatttgcgtgtggacatc
agtctggaaaaccctggcactagccctgcccttgaagcctattctgagactgccaaggtc
ttcagtattcctttccacaaagactgtggtgaggacggactttgcatttctgatctagtc
ctagatgtccgacaaataccagctgctcaagaacaaccctttattgtcagcaaccaaaac
aaaaggttaacattttcagtaacgctgaaaaataaaagggaaagtgcatacaacactgga
attgttgttgatttttcagaaaacttgttttttgcatcattctccctgccggttgatggg
acagaagtaacatgccaggtggctgcatctcagaagtctgttgcctgcgatgtaggctac
cctgctttaaagagagaacaacaggtgacttttactattaactttgacttcaatcttcaa
aaccttcagaatcaggcgtctctcagtttccaagccttaagtgaaagccaagaagaaaac
aaggctgataatttggtcaacctcaaaattcctctcctgtatgatgctgaaattcactta
acaagatctaccaacataaatttttatgaaatctcttcggatgggaatgttccttcaatc
gtgcacagttttgaagatgttggtccaaaattcatcttctccctgaaggtaacaacagga
agtgttccagtaagcatggcaactgtaatcatccacatccctcagtataccaaagaaaag
aacccactgatgtacctaactggggtgcaaacagacaaggctggtgacatcagttgtaat
gcagatatcaatccactgaaaataggacaaacatcttcttctgtatctttcaaaagtgaa
aatttcaggcacaccaaagaattgaactgcagaactgcttcctgtagtaatgttacctgc
tggttgaaagacgttcacatgaaaggagaatactttgttaatgtgactaccagaatttgg
aacgggactttcgcatcatcaacgttccagacagtacagctaacggcagctgcagaaatc
aacacctataaccctgagatatatgtgattgaagataacactgttacgattcccctgatg
ataatgaaacctgatgagaaagccgaagtaccaacaggagttataataggaagtataatt
gctggaatccttttgctgttagctctggttgcaattttatggaagctcggcttcttcaaa
agaaaatatgaaaagatgaccaaaaatccagatgagattgatgagaccacagagctcagt
agctga

KEGG   Homo sapiens (human): 3674Help
Entry
3674              CDS       T01001                                 

Gene name
ITGA2B, BDPLT16, BDPLT2, CD41, CD41B, GP2B, GPIIb, GT, GTA, HPA3, PPP1R93
Definition
(RefSeq) integrin subunit alpha 2b
  KO
K06476  integrin alpha 2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04611  Platelet activation
hsa04640  Hematopoietic cell lineage
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06135  Cytoskeletal regulation (virus)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoA signaling pathway
Disease
H00226  Glanzmann thrombasthenia
H01740  Macrothrombocytopenia
Drug target
Abciximab: D02778
Elarofiban: D03971
Eptifibatide: D06888
Lamifiban (DG01420): D04659 D04660
Lotrafiban hydrochloride: D04785
Orbofiban acetate: D05267
Roxifiban acetate: D05772
Sibrafiban: D05834
Tadocizumab: D06649
Tirofiban (DG00159): D01029 D08607
Xemilofiban hydrochloride: D06335
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    3674 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    3674 (ITGA2B)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3674 (ITGA2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3674 (ITGA2B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3674 (ITGA2B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3674 (ITGA2B)
   04611 Platelet activation
    3674 (ITGA2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3674 (ITGA2B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    3674 (ITGA2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    3674 (ITGA2B)
   05410 Hypertrophic cardiomyopathy (HCM)
    3674 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3674 (ITGA2B)
   05414 Dilated cardiomyopathy (DCM)
    3674 (ITGA2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3674 (ITGA2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    3674 (ITGA2B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3674 (ITGA2B)
   04515 Cell adhesion molecules [BR:hsa04515]
    3674 (ITGA2B)
   04090 CD molecules [BR:hsa04090]
    3674 (ITGA2B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     3674 (ITGA2B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3674 (ITGA2B)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3674 (ITGA2B)
CD molecules [BR:hsa04090]
 Proteins
  3674 (ITGA2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Motif
Other DBs
NCBI-GeneID: 3674
NCBI-ProteinID: NP_000410
OMIM: 607759
HGNC: 6138
Ensembl: ENSG00000005961
Vega: OTTHUMG00000177935
Pharos: P08514(Tclin)
UniProt: P08514
Structure
PDB: 

Position
17q21.31
AA seq 1039 aa AA seqDB search
MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDS
HGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKA
RQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGN
TLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRP
GILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEI
LDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVY
LFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQV
LVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYR
AQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQ
LDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSL
NVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADN
VLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCEL
GNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVE
LRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQP
SDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQP
SRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAW
FNVSSLPYAVPPLSLPRGEAQVWTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWK
VGFFKRNRPPLEEDDEEGE
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atggccagagctttgtgtccactgcaagccctctggcttctggagtgggtgctgctgctc
ttgggaccttgtgctgcccctccagcctgggccttgaacctggacccagtgcagctcacc
ttctatgcaggccccaatggcagccagtttggattttcactggacttccacaaggacagc
catgggagagtggccatcgtggtgggcgccccgcggaccctgggccccagccaggaggag
acgggcggcgtgttcctgtgcccctggagggccgagggcggccagtgcccctcgctgctc
tttgacctccgtgatgagacccgaaatgtaggctcccaaactttacaaaccttcaaggcc
cgccaaggactgggggcgtcggtcgtcagctggagcgacgtcattgtggcctgcgccccc
tggcagcactggaacgtcctagaaaagactgaggaggctgagaagacgcccgtaggtagc
tgctttttggctcagccagagagcggccgccgcgccgagtactccccctgtcgcgggaac
accctgagccgcatttacgtggaaaatgattttagctgggacaagcgttactgtgaagcg
ggcttcagctccgtggtcactcaggccggagagctggtgcttggggctcctggcggctat
tatttcttaggtctcctggcccaggctccagttgcggatattttctcgagttaccgccca
ggcatccttttgtggcacgtgtcctcccagagcctctcctttgactccagcaacccagag
tacttcgacggctactgggggtactcggtggccgtgggcgagttcgacggggatctcaac
actacagaatatgtcgtcggtgcccccacttggagctggaccctgggagcggtggaaatt
ttggattcctactaccagaggctgcatcggctgcgcggagagcagatggcgtcgtatttt
gggcattcagtggctgtcactgacgtcaacggggatgggaggcatgatctgctggtgggc
gctccactgtatatggagagccgggcagaccgaaaactggccgaagtggggcgtgtgtat
ttgttcctgcagccgcgaggcccccacgcgctgggtgcccccagcctcctgctgactggc
acacagctctatgggcgattcggctctgccatcgcacccctgggcgacctcgaccgggat
ggctacaatgacattgcagtggctgccccctacgggggtcccagtggccggggccaagtg
ctggtgttcctgggtcagagtgaggggctgaggtcacgtccctcccaggtcctggacagc
cccttccccacaggctctgcctttggcttctcccttcgaggtgccgtagacatcgatgac
aacggatacccagacctgatcgtgggagcttacggggccaaccaggtggctgtgtacaga
gctcagccagtggtgaaggcctctgtccagctactggtgcaagattcactgaatcctgct
gtgaagagctgtgtcctacctcagaccaagacacccgtgagctgcttcaacatccagatg
tgtgttggagccactgggcacaacattcctcagaagctatccctaaatgccgagctgcag
ctggaccggcagaagccccgccagggccggcgggtgctgctgctgggctctcaacaggca
ggcaccaccctgaacctggatctgggcggaaagcacagccccatctgccacaccaccatg
gccttccttcgagatgaggcagacttccgggacaagctgagccccattgtgctcagcctc
aatgtgtccctaccgcccacggaggctggaatggcccctgctgtcgtgctgcatggagac
acccatgtgcaggagcagacacgaatcgtcctggactgtggggaagatgacgtatgtgtg
ccccagcttcagctcactgccagcgtgacgggctccccgctcctagttggggcagataat
gtcctggagctgcagatggacgcagccaacgagggcgagggggcctatgaagcagagctg
gccgtgcacctgccccagggcgcccactacatgcgggccctaagcaatgtcgagggcttt
gagagactcatctgtaatcagaagaaggagaatgagaccagggtggtgctgtgtgagctg
ggcaaccccatgaagaagaacgcccagataggaatcgcgatgttggtgagcgtggggaat
ctggaagaggctggggagtctgtgtccttccagctgcagatacggagcaagaacagccag
aatccaaacagcaagattgtgctgctggacgtgccggtccgggcagaggcccaagtggag
ctgcgagggaactcctttccagcctccctggtggtggcagcagaagaaggtgagagggag
cagaacagcttggacagctggggacccaaagtggagcacacctatgagctccacaacaat
ggccctgggactgtgaatggtcttcacctcagcatccaccttccgggacagtcccagccc
tccgacctgctctacatcctggatatacagccccaggggggccttcagtgcttcccacag
cctcctgtcaaccctctcaaggtggactgggggctgcccatccccagcccctcccccatt
cacccggcccatcacaagcgggatcgcagacagatcttcctgccagagcccgagcagccc
tcgaggcttcaggatccagttctcgtaagctgcgactcggcgccctgtactgtggtgcag
tgtgacctgcaggagatggcgcgcgggcagcgggccatggtcacggtgctggccttcctg
tggctgcccagcctctaccagaggcctctggatcagtttgtgctgcagtcgcacgcatgg
ttcaacgtgtcctccctcccctatgcggtgcccccgctcagcctgccccgaggggaagct
caggtgtggacacagctgctccgggccttggaggagagggccattccaatctggtgggtg
ctggtgggtgtgctgggtggcctgctgctgctcaccatcctggtcctggccatgtggaag
gtcggcttcttcaagcggaaccggccacccctggaagaagatgatgaagagggggagtga

KEGG   Homo sapiens (human): 3675Help
Entry
3675              CDS       T01001                                 

Gene name
ITGA3, CD49C, FRP-2, GAP-B3, GAPB3, ILNEB, MSK18, VCA-2, VL3A, VLA3a
Definition
(RefSeq) integrin subunit alpha 3
  KO
K06482  integrin alpha 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04640  Hematopoietic cell lineage
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06135  Cytoskeletal regulation (virus)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3675 (ITGA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3675 (ITGA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3675 (ITGA3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3675 (ITGA3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3675 (ITGA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3675 (ITGA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    3675 (ITGA3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    3675 (ITGA3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3675 (ITGA3)
   05414 Dilated cardiomyopathy (DCM)
    3675 (ITGA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3675 (ITGA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3675 (ITGA3)
   04515 Cell adhesion molecules [BR:hsa04515]
    3675 (ITGA3)
   04090 CD molecules [BR:hsa04090]
    3675 (ITGA3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3675 (ITGA3)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3675 (ITGA3)
CD molecules [BR:hsa04090]
 Proteins
  3675 (ITGA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS MTABC_N MLANA
Motif
Other DBs
NCBI-GeneID: 3675
NCBI-ProteinID: NP_002195
OMIM: 605025
HGNC: 6139
Ensembl: ENSG00000005884
Vega: OTTHUMG00000161890
Pharos: P26006(Tbio)
UniProt: P26006 A0A140VJM0
Position
17q21.33
AA seq 1051 aa AA seqDB search
MGPGPSRAPRAPRLMLCALALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHR
QTERQQRYLLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKNDPGHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDSSDDWQTY
HNEMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKEWDLSEYSYK
DPEDQGNLYIGYTMQVGSFILHPKNITIVTGAPRHRHMGAVFLLSQEAGGDLRRRQVLEG
SQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYVFMNQAGTSFPAHPSLL
LHGPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLLRQPQQVIHGE
KLGLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINIVHKTLVPRPAVL
DPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFH
GFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQA
QALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNT
RTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAF
EVIGVTLHTRDLQVQLQLSTSSHQDNLWPMILTLLVDYTLQTSLSMVNHRLQSFFGGTVM
GESGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITVHG
NGSWPCRPPGDLINPLNLTLSDPGDRPSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSET
VLTCATGRAHCVWLECPIPDAPVVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRT
SIPTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGFFK
RARTRALYEAKRQKAEMKSQPSETERLTDDY
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atgggccccggccccagccgcgcgccccgcgccccacgcctgatgctctgtgcgctcgcc
ttgatggtggcggccggcggctgcgtcgtctccgccttcaacctggatacccgattcctg
gtagtgaaggaggccgggaacccgggcagcctcttcggctactcggtcgccctccatcgg
cagacagagcggcagcagcgctacctgctcctggctggtgccccccgggagctcgctgtg
cccgatggctacaccaaccggactggtgctgtgtacctgtgcccactcactgcccacaag
gatgactgtgagcggatgaacatcacagtgaaaaatgaccctggccatcacattattgag
gacatgtggcttggagtgactgtggccagccagggccctgcaggcagagttctggtctgt
gcccaccgctacacccaggtgctgtggtcagggtcagaagaccagcggcgcatggtgggc
aagtgctacgtgcgaggcaatgacctagagctggactccagtgatgactggcagacctac
cacaacgagatgtgcaatagcaacacagactacctggagacgggcatgtgccagctgggc
accagcggtggcttcacccagaacactgtgtacttcggcgcccccggtgcctacaactgg
aaaggaaacagctacatgattcagcgcaaggagtgggacttatctgagtatagttacaag
gacccagaggaccaaggaaacctctatattgggtacacgatgcaggtaggcagcttcatc
ctgcaccccaaaaacatcaccattgtgacaggtgccccacggcaccgacatatgggcgcg
gtgttcttgctgagccaggaggcaggcggagacctgcggaggaggcaggtgctggagggc
tcgcaggtgggcgcctattttggcagcgccattgccctggcagacctgaacaatgatggg
tggcaggacctcctggtgggcgccccctactacttcgagaggaaagaggaagtagggggt
gccatctatgtcttcatgaaccaggcgggaacctccttccctgctcacccctcactcctt
cttcatggccccagtggctctgcctttggtttatctgtggccagcattggtgacatcaac
caggatggatttcaggatattgctgtgggagctccgtttgaaggcttgggcaaagtgtac
atctatcacagtagctctaaggggctccttagacagccccagcaggtaatccatggagag
aagctgggactgcctgggttggccaccttcggctattccctcagtgggcagatggatgtg
gatgagaacttctacccagaccttctagtgggaagcctgtcagaccacattgtgctgctg
cgggcccggcccgtcatcaacatcgtccacaagaccttggtgcccaggccagctgtgctg
gaccctgcactttgcacggccacctcttgtgtgcaagtggagctgtgctttgcttacaac
cagagtgccgggaaccccaactacaggcgaaacatcaccctggcctacactctggaggct
gacagggaccgccggccgccccggctccgctttgccggcagtgagtccgctgtcttccac
ggcttcttctccatgcccgagatgcgctgccagaagctggagctgctcctgatggacaac
ctccgtgacaaactccgccccatcatcatctccatgaactactctttacctttgcggatg
cccgatcgcccccggctggggctgcggtccctggacgcctacccgatcctcaaccaggca
caggctctggagaaccacactgaggtccagttccagaaggagtgcgggcctgacaacaag
tgtgagagcaacttgcagatgcgggcagccttcgtgtcagagcagcagcagaagctgagc
aggctccagtacagcagagacgtccggaaattgctcctgagcatcaacgtgacgaacacc
cggacctcggagcgctccggggaggacgcccacgaggcgctgctcaccctggtggtgcct
cccgccctgctgctgtcctcagtgcgcccccccggggcctgccaagctaatgagaccatc
ttttgcgagctggggaaccccttcaaacggaaccagaggatggagctgctcatcgccttt
gaggtcatcggggtgaccctgcacacaagggaccttcaggtgcagctgcagctctccacg
tcgagtcaccaggacaacctgtggcccatgatcctcactctgctggtggactatacactc
cagacctcgcttagcatggtaaatcaccggctacaaagcttctttggggggacagtgatg
ggtgagtctggcatgaaaactgtggaggatgtaggaagccccctcaagtatgaattccag
gtgggcccaatgggggaggggctggtgggcctggggaccctggtcctaggtctggagtgg
ccctacgaagtcagcaatggcaagtggctgctgtatcccacggagatcaccgtccatggc
aatgggtcctggccctgccgaccacctggagaccttatcaaccctctcaacctcactctt
tctgaccctggggacaggccatcatccccacagcgcaggcggcgacagctggatccaggg
ggaggccagggccccccacctgtcactctggctgctgccaaaaaagccaagtctgagact
gtgctgacctgtgccacagggcgtgcccactgtgtgtggctagagtgccccatccctgat
gcccccgttgtcaccaacgtgactgtgaaggcacgagtgtggaacagcaccttcatcgag
gattacagagactttgaccgagtccgggtaaatggctgggctaccctattcctccgaacc
agcatccccaccatcaacatggagaacaagaccacgtggttctctgtggacattgactcg
gagctggtggaggagctgccggccgaaatcgagctgtggctggtgctggtggccgtgggt
gcagggctgctgctgctggggctgatcatcctcctgctgtggaagtgcggcttcttcaag
cgagcccgcactcgcgccctgtatgaagctaagaggcagaaggcggagatgaagagccag
ccgtcagagacagagaggctgaccgacgactactga

KEGG   Homo sapiens (human): 3685Help
Entry
3685              CDS       T01001                                 

Gene name
ITGAV, CD51, MSK8, VNRA, VTNR
Definition
(RefSeq) integrin subunit alpha V
  KO
K06487  integrin alpha V
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04514  Cell adhesion molecules (CAMs)
hsa04810  Regulation of actin cytoskeleton
hsa04919  Thyroid hormone signaling pathway
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05222  Small cell lung cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06135  Cytoskeletal regulation (virus)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoA signaling pathway
N00394  HCMV gH to ITGA/B-RhoA signaling pathway
Drug target
Cilengitide: D03497
Etaracizumab: D09342
Fluciclatide F 18: D09903
Intetumumab: D09631
Maraciclatide: D09929
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3685 (ITGAV)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3685 (ITGAV)
   04514 Cell adhesion molecules (CAMs)
    3685 (ITGAV)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3685 (ITGAV)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3685 (ITGAV)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3685 (ITGAV)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    3685 (ITGAV)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3685 (ITGAV)
   05205 Proteoglycans in cancer
    3685 (ITGAV)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    3685 (ITGAV)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    3685 (ITGAV)
   05410 Hypertrophic cardiomyopathy (HCM)
    3685 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3685 (ITGAV)
   05414 Dilated cardiomyopathy (DCM)
    3685 (ITGAV)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    3685 (ITGAV)
   05165 Human papillomavirus infection
    3685 (ITGAV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3685 (ITGAV)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3685 (ITGAV)
   04515 Cell adhesion molecules [BR:hsa04515]
    3685 (ITGAV)
   04090 CD molecules [BR:hsa04090]
    3685 (ITGAV)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    3685 (ITGAV)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3685 (ITGAV)
  Exosomal proteins of epithelial cells
   3685 (ITGAV)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3685 (ITGAV)
CD molecules [BR:hsa04090]
 Proteins
  3685 (ITGAV)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Motif
Other DBs
NCBI-GeneID: 3685
NCBI-ProteinID: NP_002201
OMIM: 193210
HGNC: 6150
Ensembl: ENSG00000138448
Vega: OTTHUMG00000132635
Pharos: P06756(Tchem)
UniProt: P06756 L7RXH0
Structure
PDB: 

Position
2q32.1
AA seq 1048 aa AA seqDB search
MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQI
LEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVY
PSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRR
ALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAAD
TTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVK
AQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSP
DHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLY
ILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIH
TLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIE
FPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGF
FKRVRPPQEEQEREQLQPHENGEGNSET
NT seq 3147 nt NT seq  +upstreamnt  +downstreamnt
atggcttttccgccgcggcgacggctgcgcctcggtccccgcggcctcccgcttcttctc
tcgggactcctgctacctctgtgccgcgccttcaacctagacgtggacagtcctgccgag
tactctggccccgagggaagttacttcggcttcgccgtggatttcttcgtgcccagcgcg
tcttcccggatgtttcttctcgtgggagctcccaaagcaaacaccacccagcctgggatt
gtggaaggagggcaggtcctcaaatgtgactggtcttctacccgccggtgccagccaatt
gaatttgatgcaacaggcaatagagattatgccaaggatgatccattggaatttaagtcc
catcagtggtttggagcatctgtgaggtcgaaacaggataaaattttggcctgtgcccca
ttgtaccattggagaactgagatgaaacaggagcgagagcctgttggaacatgctttctt
caagatggaacaaagactgttgagtatgctccatgtagatcacaagatattgatgctgat
ggacagggattttgtcaaggaggattcagcattgattttactaaagctgacagagtactt
cttggtggtcctggtagcttttattggcaaggtcagcttatttcggatcaagtggcagaa
atcgtatctaaatacgaccccaatgtttacagcatcaagtataataaccaattagcaact
cggactgcacaagctatttttgatgacagctatttgggttattctgtggctgtcggagat
ttcaatggtgatggcatagatgactttgtttcaggagttccaagagcagcaaggactttg
ggaatggtttatatttatgatgggaagaacatgtcctccttatacaattttactggcgag
cagatggctgcatatttcggattttctgtagctgccactgacattaatggagatgattat
gcagatgtgtttattggagcacctctcttcatggatcgtggctctgatggcaaactccaa
gaggtggggcaggtctcagtgtctctacagagagcttcaggagacttccagacgacaaag
ctgaatggatttgaggtctttgcacggtttggcagtgccatagctcctttgggagatctg
gaccaggatggtttcaatgatattgcaattgctgctccatatgggggtgaagataaaaaa
ggaattgtttatatcttcaatggaagatcaacaggcttgaacgcagtcccatctcaaatc
cttgaagggcagtgggctgctcgaagcatgccaccaagctttggctattcaatgaaagga
gccacagatatagacaaaaatggatatccagacttaattgtaggagcttttggtgtagat
cgagctatcttatacagggccagaccagttatcactgtaaatgctggtcttgaagtgtac
cctagcattttaaatcaagacaataaaacctgctcactgcctggaacagctctcaaagtt
tcctgttttaatgttaggttctgcttaaaggcagatggcaaaggagtacttcccaggaaa
cttaatttccaggtggaacttcttttggataaactcaagcaaaagggagcaattcgacga
gcactgtttctctacagcaggtccccaagtcactccaagaacatgactatttcaaggggg
ggactgatgcagtgtgaggaattgatagcgtatctgcgggatgaatctgaatttagagac
aaactcactccaattactatttttatggaatatcggttggattatagaacagctgctgat
acaacaggcttgcaacccattcttaaccagttcacgcctgctaacattagtcgacaggct
cacattctacttgactgtggtgaagacaatgtctgtaaacccaagctggaagtttctgta
gatagtgatcaaaagaagatctatattggggatgacaaccctctgacattgattgttaag
gctcagaatcaaggagaaggtgcctacgaagctgagctcatcgtttccattccactgcag
gctgatttcatcggggttgtccgaaacaatgaagccttagcaagactttcctgtgcattt
aagacagaaaaccaaactcgccaggtggtatgtgaccttggaaacccaatgaaggctgga
actcaactcttagctggtcttcgtttcagtgtgcaccagcagtcagagatggatacttct
gtgaaatttgacttacaaatccaaagctcaaatctatttgacaaagtaagcccagttgta
tctcacaaagttgatcttgctgttttagctgcagttgagataagaggagtctcgagtcct
gatcatgtctttcttccgattccaaactgggagcacaaggagaaccctgagactgaagaa
gatgttgggccagttgttcagcacatctatgagctgagaaacaatggtccaagttcattc
agcaaggcaatgctccatcttcagtggccttacaaatataataataacactctgttgtat
atccttcattatgatattgatggaccaatgaactgcacttcagatatggagatcaaccct
ttgagaattaagatctcatctttgcaaacaactgaaaagaatgacacggttgccgggcaa
ggtgagcgggaccatctcatcactaagcgggatcttgccctcagtgaaggagatattcac
actttgggttgtggagttgctcagtgcttgaagattgtctgccaagttgggagattagac
agaggaaagagtgcaatcttgtacgtaaagtcattactgtggactgagacttttatgaat
aaagaaaatcagaatcattcctattctctgaagtcgtctgcttcatttaatgtcatagag
tttccttataagaatcttccaattgaggatatcaccaactccacattggttaccactaat
gtcacctggggcattcagccagcgcccatgcctgtgcctgtgtgggtgatcattttagca
gttctagcaggattgttgctactggctgttttggtatttgtaatgtacaggatgggcttt
tttaaacgggtccggccacctcaagaagaacaagaaagggagcagcttcaacctcatgaa
aatggtgaaggaaactcagaaacttaa

DBGET integrated database retrieval system