KEGG   Homo sapiens (human): 3659Help
Entry
3659              CDS       T01001                                 

Gene name
IRF1, IRF-1, MAR
Definition
(RefSeq) interferon regulatory factor 1
  KO
K09444  interferon regulatory factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04917  Prolactin signaling pathway
hsa05133  Pertussis
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
Network
N00195  HPV E7 to host-cell-protein inhibition
N00374  TNF-IRF1 signaling pathway
N00375  HPV E7 to TNF-IRF1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    3659 (IRF1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    3659 (IRF1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    3659 (IRF1)
 09160 Human Diseases
  09167 Infectious diseases
   05133 Pertussis
    3659 (IRF1)
   05160 Hepatitis C
    3659 (IRF1)
   05165 Human papillomavirus infection
    3659 (IRF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3659 (IRF1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    3659 (IRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRF
Motif
Other DBs
NCBI-GeneID: 3659
NCBI-ProteinID: NP_002189
OMIM: 147575
HGNC: 6116
Ensembl: ENSG00000125347
Vega: OTTHUMG00000059497
Pharos: P10914(Tbio)
UniProt: P10914 Q6FHN8
Position
5q31.1
AA seq 325 aa AA seqDB search
MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAI
HTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQR
KERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALT
PALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKL
LEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKN
MDATWLDSLLTPVRLPSIQAIPCAP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcactcggatgcgcatgagaccctggctagagatgcagattaattccaaccaa
atcccggggctcatctggattaataaagaggagatgatcttccagatcccatggaagcat
gctgccaagcatggctgggacatcaacaaggatgcctgtttgttccggagctgggccatt
cacacaggccgatacaaagcaggggaaaaggagccagatcccaagacgtggaaggccaac
tttcgctgtgccatgaactccctgccagatatcgaggaggtgaaagaccagagcaggaac
aagggcagctcagctgtgcgagtgtaccggatgcttccacctctcaccaagaaccagaga
aaagaaagaaagtcgaagtccagccgagatgctaagagcaaggccaagaggaagtcatgt
ggggattccagccctgataccttctctgatggactcagcagctccactctgcctgatgac
cacagcagctacacagttccaggctacatgcaggacttggaggtggagcaggccctgact
ccagcactgtcgccatgtgctgtcagcagcactctccccgactggcacatcccagtggaa
gttgtgccggacagcaccagtgatctgtacaacttccaggtgtcacccatgccctccacc
tctgaagctacaacagatgaggatgaggaagggaaattacctgaggacatcatgaagctc
ttggagcagtcggagtggcagccaacaaacgtggatgggaaggggtacctactcaatgaa
cctggagtccagcccacctctgtctatggagactttagctgtaaggaggagccagaaatt
gacagcccagggggggatattgggctgagtctacagcgtgtcttcacagatctgaagaac
atggatgccacctggctggacagcctgctgaccccagtccggttgccctccatccaggcc
attccctgtgcaccgtag

DBGET integrated database retrieval system