KEGG   Homo sapiens (human): 366
Entry
366               CDS       T01001                                 
Symbol
AQP9, AQP-9, HsT17287, SSC1, T17287
Name
(RefSeq) aquaporin 9
  KO
K09877  aquaporin-9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    366 (AQP9)
  09154 Digestive system
   04976 Bile secretion
    366 (AQP9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    366 (AQP9)
Transporters [BR:hsa02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    366 (AQP9)
SSDB
Motif
Pfam: MIP DUF6264
Other DBs
NCBI-GeneID: 366
NCBI-ProteinID: NP_066190
OMIM: 602914
HGNC: 643
Ensembl: ENSG00000103569
Pharos: O43315(Tbio)
UniProt: O43315
Position
15:58138169..58185911
AA seq 295 aa
MQPEGAEKGKSFKQRLVLKSSLAKETLSEFLGTFILIVLGCGCVAQAILSRGRFGGVITI
NVGFSMAVAMAIYVAGGVSGGHINPAVSLAMCLFGRMKWFKLPFYVGAQFLGAFVGAATV
FGIYYDGLMSFAGGKLLIVGENATAHIFATYPAPYLSLANAFADQVVATMILLIIVFAIF
DSRNLGAPRGLEPIAIGLLIIVIASSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFRAG
NNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM
NT seq 888 nt   +upstreamnt  +downstreamnt
atgcagcctgagggagcagaaaagggaaaaagcttcaagcagagactggtcttgaagagc
agcttagcgaaagaaaccctctctgagttcttgggcacgttcatcttgattgtccttgga
tgtggctgtgttgcccaagctattctcagtcgaggacgttttggaggggtcatcactatc
aatgttggattttcaatggcagttgcaatggccatttatgtggctggcggtgtctctggt
ggtcacatcaacccagctgtgtctttagcaatgtgtctctttggacggatgaaatggttc
aaattgccattttatgtgggagcccagttcttgggagcctttgtgggggctgcaaccgtc
tttggcatttactatgatggacttatgtcctttgctggtggaaaactgctgatcgtggga
gaaaatgcaacagcacacatttttgcaacatacccagctccgtatctatctctggcgaac
gcatttgcagatcaagtggtggccaccatgatactcctcataatcgtctttgccatcttt
gactccagaaacttgggagcccccagaggcctagagcccattgccatcggcctcctgatt
attgtcattgcttcctccctgggactgaacagtggctgtgccatgaacccagctcgagac
ctgagtcccagacttttcactgccttggcaggctgggggtttgaagtcttcagagctgga
aacaacttctggtggattcctgtagtgggccctttggttggtgctgtcattggaggcctc
atctatgttcttgtcattgaaatccaccatccagagcctgactcagtctttaagacagaa
caatctgaggacaaaccagagaaatatgaactcagtgtcatcatgtag

DBGET integrated database retrieval system