KEGG   Homo sapiens (human): 3660
Entry
3660              CDS       T01001                                 

Gene name
IRF2, IRF-2
Definition
(RefSeq) interferon regulatory factor 2
  KO
K10153  interferon regulatory factor 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3660 (IRF2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    3660 (IRF2)
SSDB
Motif
Pfam: IRF Heme_oxygenase
Other DBs
NCBI-GeneID: 3660
NCBI-ProteinID: NP_002190
OMIM: 147576
HGNC: 6117
Ensembl: ENSG00000168310
Vega: OTTHUMG00000160606
Pharos: P14316(Tbio)
UniProt: P14316
Position
4q35.1
AA seq 349 aa
MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAI
HTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSK
KGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQ
SHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSELYPLQISPVSSYAESETTDSVP
SDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVP
YNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgccggtggaaaggatgcgcatgcgcccgtggctggaggagcagataaactccaacacg
atcccggggctcaagtggcttaacaaggaaaagaagatttttcagatcccctggatgcat
gcggctagacatgggtgggatgtggaaaaagatgcaccactctttagaaactgggcaatc
catacaggaaagcatcaaccaggagtagataaacctgatcccaaaacatggaaggcgaat
ttcagatgcgccatgaattccttgcctgatattgaagaagtcaaggataaaagcataaag
aaaggaaataatgccttcagggtctaccgaatgctgcccctatcagaacggccttctaag
aaaggaaagaaaccaaagacagaaaaagaagacaaagttaagcacatcaagcaagaacca
gttgagtcatctctggggcttagtaatggagtaagtgatctttctcctgagtatgcggtc
ctgacttcaactataaaaaatgaagtggatagtacggtgaacatcatagttgtaggacag
tcccatctggacagcaacattgagaatcaagagattgtcaccaatccgccagacatttgc
caagttgtagaggtgaccactgagagcgacgagcagccggtcagcatgagcgagctctac
cctctgcagatctcccccgtgtcttcctatgcagaaagcgaaacgactgatagtgtgccc
agcgatgaagagagtgccgaggggcggccacactggcggaagaggaatattgaaggcaaa
cagtacctcagcaacatggggactcgaggctcctacctgctgcccggcatggcgtccttc
gtcacttccaacaaaccggacctccaggtcaccatcaaagaggagagcaatccggtgcct
tacaacagctcctggcccccttttcaagacctccccctttcttcctccatgaccccagca
tccagcagcagtcggccagaccgggagacccgggccagcgtcatcaagaaaacatcggat
atcacccaggcccgcgtcaagagctgttaa

DBGET integrated database retrieval system