KEGG   Homo sapiens (human): 3661Help
Entry
3661              CDS       T01001                                 

Gene name
IRF3, IIAE7
Definition
(RefSeq) interferon regulatory factor 3
  KO
K05411  interferon regulatory factor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa05133  Pertussis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
Network
N00149  TLR3-IRF3 signaling pathway
N00161  KSHV vIRF1/2 to TLR3-IRF3 signaling pathway
N00268  HBV HBx to RIG-I-like receptor signaling pathway
N00271  HCV NS3/4A to RIG-I-like receptor signaling pathway
N00346  HPV E6 to TLR-IRF3 signaling pathway
N00395  cGAS-STING signaling pathway
N00396  HCMV UL82 to cGAS-STING signaling pathway
N00440  HIV Vpu/Vif/Vpr to cGAS-STING signaling pathway
N00469  RIG-I signaling pathway
N00470  EBV BGLF4 to RIG-I-like receptor signaling pathway
N00516  HCV NS3/4A to TLR3-IRF3 signaling pathway
N00517  HCV NS3/4A to TLR3-IRF3 signaling pathway
N00552  HBV pol to TLR3-IRF3 signaling pathway
N00553  TLR4-IRF3/7 signaling pathway
N00554  HBV HBe to TLR4-IRF3/7 signaling pathway
N00555  HBV HBe to TLR4-IRF3/7 signaling pathway
N00565  HSV US11 to RIG-I-like receptor signaling pathway
N00566  HSV UL36USP to RIG-I-like receptor signaling pathway
N00567  HSV ICP34.5 to TBK1 signaling pathway
N00568  HSV US3 to IRF3 signaling pathway
N00569  HSV UL41 to cGAS-STING signaling pathway
N00570  HSV ICP0 to cGAS-STING signaling pathway
 » show all
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3661 (IRF3)
   04621 NOD-like receptor signaling pathway
    3661 (IRF3)
   04622 RIG-I-like receptor signaling pathway
    3661 (IRF3)
   04623 Cytosolic DNA-sensing pathway
    3661 (IRF3)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    3661 (IRF3)
  09171 Infectious diseases: Bacterial
   05133 Pertussis
    3661 (IRF3)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    3661 (IRF3)
   05162 Measles
    3661 (IRF3)
   05164 Influenza A
    3661 (IRF3)
   05161 Hepatitis B
    3661 (IRF3)
   05160 Hepatitis C
    3661 (IRF3)
   05168 Herpes simplex virus 1 infection
    3661 (IRF3)
   05163 Human cytomegalovirus infection
    3661 (IRF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3661 (IRF3)
   05169 Epstein-Barr virus infection
    3661 (IRF3)
   05165 Human papillomavirus infection
    3661 (IRF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3661 (IRF3)
   04131 Membrane trafficking [BR:hsa04131]
    3661 (IRF3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    3661 (IRF3)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    3661 (IRF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRF-3 IRF
Motif
Other DBs
NCBI-GeneID: 3661
NCBI-ProteinID: NP_001562
OMIM: 603734
HGNC: 6118
Ensembl: ENSG00000126456
Vega: OTTHUMG00000183287
Pharos: Q14653(Tbio)
UniProt: Q14653
Structure
PDB: 

Position
19q13.33
AA seq 427 aa AA seqDB search
MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEA
TGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQP
DTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPT
PFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPG
WPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELL
PNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTK
RLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMD
FQGPGES
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccccaaagccacggatcctgccctggctggtgtcgcagctggacctggggcaa
ctggagggcgtggcctgggtgaacaagagccgcacgcgcttccgcatcccttggaagcac
ggcctacggcaggatgcacagcaggaggatttcggaatcttccaggcctgggccgaggcc
actggtgcatatgttcccgggagggataagccagacctgccaacctggaagaggaatttc
cgctctgccctcaaccgcaaagaagggttgcgtttagcagaggaccggagcaaggaccct
cacgacccacataaaatctacgagtttgtgaactcaggagttggggacttttcccagcca
gacacctctccggacaccaatggtggaggcagtacttctgatacccaggaagacattctg
gatgagttactgggtaacatggtgttggccccactcccagatccgggacccccaagcctg
gctgtagcccctgagccctgccctcagcccctgcggagccccagcttggacaatcccact
cccttcccaaacctggggccctctgagaacccactgaagcggctgttggtgccgggggaa
gagtgggagttcgaggtgacagccttctaccggggccgccaagtcttccagcagaccatc
tcctgcccggagggcctgcggctggtggggtccgaagtgggagacaggacgctgcctgga
tggccagtcacactgccagaccctggcatgtccctgacagacaggggagtgatgagctac
gtgaggcatgtgctgagctgcctgggtgggggactggctctctggcgggccgggcagtgg
ctctgggcccagcggctggggcactgccacacatactgggcagtgagcgaggagctgctc
cccaacagcgggcatgggcctgatggcgaggtccccaaggacaaggaaggaggcgtgttt
gacctggggcccttcattgtagatctgattaccttcacggaaggaagcggacgctcacca
cgctatgccctctggttctgtgtgggggagtcatggccccaggaccagccgtggaccaag
aggctcgtgatggtcaaggttgtgcccacgtgcctcagggccttggtagaaatggcccgg
gtagggggtgcctcctccctggagaatactgtggacctgcacatttccaacagccaccca
ctctccctcacctccgaccagtacaaggcctacctgcaggacttggtggagggcatggat
ttccagggccctggggagagctga

DBGET integrated database retrieval system