KEGG   Homo sapiens (human): 3662Help
Entry
3662              CDS       T01001                                 

Gene name
IRF4, LSIRF, MUM1, NF-EM5, SHEP8
Definition
(RefSeq) interferon regulatory factor 4
  KO
K09445  interferon regulatory factor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    3662 (IRF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3662 (IRF4)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    3662 (IRF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRF-3 IRF MH2
Motif
Other DBs
NCBI-GeneID: 3662
NCBI-ProteinID: NP_002451
OMIM: 601900
HGNC: 6119
Ensembl: ENSG00000137265
Vega: OTTHUMG00000016294
Pharos: Q15306(Tbio)
UniProt: Q15306
Structure
PDB: 

Position
6p25.3
AA seq 451 aa AA seqDB search
MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQ
DYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISD
PYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRD
YVPDQPHPEIPYQCPMTFGPRGHHWQGPACENGCQVTGTFYACAPPESQAPGVPTEPSIR
SAEALAFSDCRLHICLYYREILVKELTTSSPEGCRISHGHTYDASNLDQVLFPYPEDNGQ
RKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKLERDQTCKLFD
TQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQN
SGHFLRGYDLPEHISNPEDYHRSIRHSSIQE
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaacctggagggcggcggccgaggcggagagttcggcatgagcgcggtgagctgcggc
aacgggaagctccgccagtggctgatcgaccagatcgacagcggcaagtaccccgggctg
gtgtgggagaacgaggagaagagcatcttccgcatcccctggaagcacgcgggcaagcag
gactacaaccgcgaggaggacgccgcgctcttcaaggcttgggcactgtttaaaggaaag
ttccgagaaggcatcgacaagccggaccctcccacctggaagacgcgcctgcggtgcgct
ttgaacaagagcaatgactttgaggaactggttgagcggagccagctggacatctcagac
ccgtacaaagtgtacaggattgttcctgagggagccaaaaaaggagccaagcagctcacc
ctggaggacccgcagatgtccatgagccacccctacaccatgacaacgccttacccttcg
ctcccagcccagcaggttcacaactacatgatgccacccctcgaccgaagctggagggac
tacgtcccggatcagccacacccggaaatcccgtaccaatgtcccatgacgtttggaccc
cgcggccaccactggcaaggcccagcttgtgaaaatggttgccaggtgacaggaaccttt
tatgcttgtgccccacctgagtcccaggctcccggagtccccacagagccaagcataagg
tctgccgaagccttggcgttctcagactgccggctgcacatctgcctgtactaccgggaa
atcctcgtgaaggagctgaccacgtccagccccgagggctgccggatctcccatggacat
acgtatgacgccagcaacctggaccaggtcctgttcccctacccagaggacaatggccag
aggaaaaacattgagaagctgctgagccacctggagaggggcgtggtcctctggatggcc
cccgacgggctctatgcgaaaagactgtgccagagcaggatctactgggacgggcccctg
gcgctgtgcaacgaccggcccaacaaactggagagagaccagacctgcaagctctttgac
acacagcagttcttgtcagagctgcaagcgtttgctcaccacggccgctccctgccaaga
ttccaggtgactctatgctttggagaggagtttccagaccctcagaggcaaagaaagctc
atcacagctcacgtagaacctctgctagccagacaactatattattttgctcaacaaaac
agtggacatttcctgaggggctacgatttaccagaacacatcagcaatccagaagattac
cacagatctatccgccattcctctattcaagaatga

DBGET integrated database retrieval system