KEGG   Homo sapiens (human): 3665Help
Entry
3665              CDS       T01001                                 

Gene name
IRF7, IMD39, IRF-7, IRF-7H, IRF7A, IRF7B, IRF7C, IRF7H
Definition
(RefSeq) interferon regulatory factor 7
  KO
K09447  interferon regulatory factor 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05164  Influenza A
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00162  KSHV vIRF3 to TLR3-IRF7 signaling pathway
N00163  KSHV KIE1/2 to TLR3-IRF7 signaling pathway
N00261  KSHV vIRF2 to IFN signaling pathway
N00268  HBV HBx to RIG-I-like receptor signaling pathway
N00271  HCV NS3/4A to RIG-I-like receptor signaling pathway
N00469  RIG-I signaling pathway
N00471  EBV LMP2A/2B to IFN signaling pathway
N00472  EBV LMP1 to IFN signaling pathway
N00473  EBV BGLF4 to IFN signaling pathway
N00516  HCV NS3/4A to TLR3-IRF3 signaling pathway
N00553  TLR4-IRF3/7 signaling pathway
N00554  HBV HBe to TLR4-IRF3/7 signaling pathway
N00555  HBV HBe to TLR4-IRF3/7 signaling pathway
N00565  HSV US11 to RIG-I-like receptor signaling pathway
N00566  HSV UL36USP to RIG-I-like receptor signaling pathway
N00567  HSV ICP34.5 to TBK1 signaling pathway
 » show all
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3665 (IRF7)
   04621 NOD-like receptor signaling pathway
    3665 (IRF7)
   04622 RIG-I-like receptor signaling pathway
    3665 (IRF7)
   04623 Cytosolic DNA-sensing pathway
    3665 (IRF7)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    3665 (IRF7)
  09172 Infectious diseases: Viral
   05162 Measles
    3665 (IRF7)
   05164 Influenza A
    3665 (IRF7)
   05161 Hepatitis B
    3665 (IRF7)
   05160 Hepatitis C
    3665 (IRF7)
   05168 Herpes simplex virus 1 infection
    3665 (IRF7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3665 (IRF7)
   05169 Epstein-Barr virus infection
    3665 (IRF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3665 (IRF7)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    3665 (IRF7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRF-3 IRF
Motif
Other DBs
NCBI-GeneID: 3665
NCBI-ProteinID: NP_001563
OMIM: 605047
HGNC: 6122
Ensembl: ENSG00000185507
Vega: OTTHUMG00000132019
Pharos: Q92985(Tbio)
UniProt: Q92985
Position
11p15.5
AA seq 503 aa AA seqDB search
MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIF
KAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHK
VYALSRELCWREGPGTDQTEAEAPAAVPPPQGGPPGPFLAHTHAGLQAPGPLPAPAGDKG
DLLLQAVQQSCLADHLLTASWGADPVPTKAPGEGQEGLPLTGACAGGPGLPAGELYGWAV
ETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTAVQEPSPGALDVTIMYKGRTV
LQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLE
LRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRAR
QRRGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLSL
CLSSANSLYDDIECFLMELEQPA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggccttggctcctgagagggcagccccacgcgtgctgttcggagagtggctccttgga
gagatcagcagcggctgctatgaggggctgcagtggctggacgaggcccgcacctgtttc
cgcgtgccctggaagcacttcgcgcgcaaggacctgagcgaggccgacgcgcgcatcttc
aaggcctgggctgtggcccgcggcaggtggccgcctagcagcaggggaggtggcccgccc
cccgaggctgagactgcggagcgcgccggctggaaaaccaacttccgctgcgcactgcgc
agcacgcgtcgcttcgtgatgctgcgggataactcgggggacccggccgacccgcacaag
gtgtacgcgctcagccgggagctgtgctggcgagaaggcccaggcacggaccagactgag
gcagaggcccccgcagctgtcccaccaccacagggtgggcccccagggccattcctggca
cacacacatgctggactccaagccccaggccccctccctgccccagctggtgacaagggg
gacctcctgctccaggcagtgcaacagagctgcctggcagaccatctgctgacagcgtca
tggggggcagatccagtcccaaccaaggctcctggagagggacaagaagggcttcccctg
actggggcctgtgctggaggcccagggctccctgctggggagctgtacgggtgggcagta
gagacgacccccagccccgggccccagcccgcggcactaacgacaggcgaggccgcggcc
ccagagtccccgcaccaggcagagccgtacctgtcaccctccccaagcgcctgcaccgcg
gtgcaagagcccagcccaggggcgctggacgtgaccatcatgtacaagggccgcacggtg
ctgcagaaggtggtgggacacccgagctgcacgttcctatacggccccccagacccagct
gtccgggccacagacccccagcaggtagcattccccagccctgccgagctcccggaccag
aagcagctgcgctacacggaggaactgctgcggcacgtggcccctgggttgcacctggag
cttcgggggccacagctgtgggcccggcgcatgggcaagtgcaaggtgtactgggaggtg
ggcggacccccaggctccgccagcccctccaccccagcctgcctgctgcctcggaactgt
gacacccccatcttcgacttcagagtcttcttccaagagctggtggaattccgggcacgg
cagcgccgtggctccccacgctataccatctacctgggcttcgggcaggacctgtcagct
gggaggcccaaggagaagagcctggtcctggtgaagctggaaccctggctgtgccgagtg
cacctagagggcacgcagcgtgagggtgtgtcttccctggatagcagcagcctcagcctc
tgcctgtccagcgccaacagcctctatgacgacatcgagtgcttccttatggagctggag
cagcccgcctag

DBGET integrated database retrieval system