KEGG   Homo sapiens (human): 367Help
Entry
367               CDS       T01001                                 

Gene name
AR, AIS, AR8, DHTR, HUMARA, HYSP1, KD, NR3C4, SBMA, SMAX1, TFM
Definition
(RefSeq) androgen receptor
  KO
K08557  androgen receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa05200  Pathways in cancer
hsa05215  Prostate cancer
Network
N00083  Androgen receptor signaling pathway
N00084  Amplified AR to androgen receptor signaling pathway
N00085  Mutation-activated AR to androgen receptor signaling pathway
Disease
H00024  Prostate cancer
H00062  Spinal and bulbar muscular atrophy (SBMA)
H00455  Spinal muscular atrophy (SMA)
H00608  46,XY disorders of sex development (Disorders in androgen synthesis or action)
H00609  46,XY disorders of sex development (Other)
Drug target
Androstanolone: D07456
Apalutamide: D11040
Benorterone: D03079
Bicalutamide: D00961
Bolasterone: D03144
Boldenone (DG01275): D03145 D07536
Chlormadinone (DG00469): D01299 D07670
Clometherone: D03551
Cyproterone (DG00475): D01368 D07766
Danazol: D00289
Darolutamide: D11045
Delmadinone: D07783
Delmadinone acetate: D03675
Dromostanolone propionate: D01534
Enobosarm: D10221
Enzalutamide: D10218
Fluoxymesterone: D00327
Flutamide: D00586
Mestanolone: D01533
Mesterolone: D04947
Metandienone: D00389
Metenolone (DG00140): D01301 D01375 D08193
Methandriol (DG01276): D08196 D08197
Methyltestosterone: D00408
Mibolerone: D05025
Nandrolone (DG00142): D00955 D00956 D01476 D01737 D05116 D08250 D08251
Nilutamide: D00965
Nisterime acetate: D05174
Norethandrolone: D07127
Oxabolone cipionate: D01149
Oxandrolone: D00462
Oxendolone: D01329
Oxymetholone: D00490
Prasterone (DG00141): D01616 D08409
Quinbolone: D05674
Silandrone: D05837
Stanozolol: D00444
Testosterone (DG00460): D00075 D00957 D00958 D00959 D06085 D06086 D06087 D08573 D08574
Topterone: D06191
Zanoterone: D06357
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    367 (AR)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    367 (AR)
   05215 Prostate cancer
    367 (AR)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    367 (AR)
Nuclear receptors [BR:hsa03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   367 (AR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Androgen_recep Hormone_recep zf-C4 U3_snoRNA_assoc Presenilin
Motif
Other DBs
NCBI-GeneID: 367
NCBI-ProteinID: NP_000035
OMIM: 313700
HGNC: 644
Ensembl: ENSG00000169083
Vega: OTTHUMG00000021740
Pharos: P10275(Tclin)
UniProt: P10275 Q9NUA2
Structure
PDB: 

Position
Xq12
AA seq 920 aa AA seqDB search
MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQ
QQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQ
SALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSAD
LKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELC
KAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAG
KSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQ
SRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAA
GPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAP
YGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRL
ETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRN
DCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKL
TVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWA
KALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSR
MYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELD
RIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEII
SVQVPKILSGKVKPIYFHTQ
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgcagttagggctgggaagggtctaccctcggccgccgtccaagacctaccga
ggagctttccagaatctgttccagagcgtgcgcgaagtgatccagaacccgggccccagg
cacccagaggccgcgagcgcagcacctcccggcgccagtttgctgctgctgcagcagcag
cagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcaa
gagactagccccaggcagcagcagcagcagcagggtgaggatggttctccccaagcccat
cgtagaggccccacaggctacctggtcctggatgaggaacagcaaccttcacagccgcag
tcggccctggagtgccaccccgagagaggttgcgtcccagagcctggagccgccgtggcc
gccagcaaggggctgccgcagcagctgccagcacctccggacgaggatgactcagctgcc
ccatccacgttgtccctgctgggccccactttccccggcttaagcagctgctccgctgac
cttaaagacatcctgagcgaggccagcaccatgcaactccttcagcaacagcagcaggaa
gcagtatccgaaggcagcagcagcgggagagcgagggaggcctcgggggctcccacttcc
tccaaggacaattacttagggggcacttcgaccatttctgacaacgccaaggagttgtgt
aaggcagtgtcggtgtccatgggcctgggtgtggaggcgttggagcatctgagtccaggg
gaacagcttcggggggattgcatgtacgccccacttttgggagttccacccgctgtgcgt
cccactccttgtgccccattggccgaatgcaaaggttctctgctagacgacagcgcaggc
aagagcactgaagatactgctgagtattcccctttcaagggaggttacaccaaagggcta
gaaggcgagagcctaggctgctctggcagcgctgcagcagggagctccgggacacttgaa
ctgccgtctaccctgtctctctacaagtccggagcactggacgaggcagctgcgtaccag
agtcgcgactactacaactttccactggctctggccggaccgccgccccctccgccgcct
ccccatccccacgctcgcatcaagctggagaacccgctggactacggcagcgcctgggcg
gctgcggcggcgcagtgccgctatggggacctggcgagcctgcatggcgcgggtgcagcg
ggacccggttctgggtcaccctcagccgccgcttcctcatcctggcacactctcttcaca
gccgaagaaggccagttgtatggaccgtgtggtggtggtgggggtggtggcggcggcggc
ggcggcggcggcggcggcggcggcggcggcggcggcggcgaggcgggagctgtagccccc
tacggctacactcggccccctcaggggctggcgggccaggaaagcgacttcaccgcacct
gatgtgtggtaccctggcggcatggtgagcagagtgccctatcccagtcccacttgtgtc
aaaagcgaaatgggcccctggatggatagctactccggaccttacggggacatgcgtttg
gagactgccagggaccatgttttgcccattgactattactttccaccccagaagacctgc
ctgatctgtggagatgaagcttctgggtgtcactatggagctctcacatgtggaagctgc
aaggtcttcttcaaaagagccgctgaagggaaacagaagtacctgtgcgccagcagaaat
gattgcactattgataaattccgaaggaaaaattgtccatcttgtcgtcttcggaaatgt
tatgaagcagggatgactctgggagcccggaagctgaagaaacttggtaatctgaaacta
caggaggaaggagaggcttccagcaccaccagccccactgaggagacaacccagaagctg
acagtgtcacacattgaaggctatgaatgtcagcccatctttctgaatgtcctggaagcc
attgagccaggtgtagtgtgtgctggacacgacaacaaccagcccgactcctttgcagcc
ttgctctctagcctcaatgaactgggagagagacagcttgtacacgtggtcaagtgggcc
aaggccttgcctggcttccgcaacttacacgtggacgaccagatggctgtcattcagtac
tcctggatggggctcatggtgtttgccatgggctggcgatccttcaccaatgtcaactcc
aggatgctctacttcgcccctgatctggttttcaatgagtaccgcatgcacaagtcccgg
atgtacagccagtgtgtccgaatgaggcacctctctcaagagtttggatggctccaaatc
accccccaggaattcctgtgcatgaaagcactgctactcttcagcattattccagtggat
gggctgaaaaatcaaaaattctttgatgaacttcgaatgaactacatcaaggaactcgat
cgtatcattgcatgcaaaagaaaaaatcccacatcctgctcaagacgcttctaccagctc
accaagctcctggactccgtgcagcctattgcgagagagctgcatcagttcacttttgac
ctgctaatcaagtcacacatggtgagcgtggactttccggaaatgatggcagagatcatc
tctgtgcaagtgcccaagatcctttctgggaaagtcaagcccatctatttccacacccag
tga

DBGET integrated database retrieval system