KEGG   Homo sapiens (human): 3673Help
Entry
3673              CDS       T01001                                 

Gene name
ITGA2, BR, CD49B, GPIa, HPA-5, VLA-2, VLAA2
Definition
(RefSeq) integrin subunit alpha 2
  KO
K06481  integrin alpha 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04611  Platelet activation
hsa04640  Hematopoietic cell lineage
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05222  Small cell lung cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Network
N00393  ITGA/B-RhoA signaling pathway
Disease
H01235  Bleeding disorder platelet-type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3673 (ITGA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3673 (ITGA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3673 (ITGA2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3673 (ITGA2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3673 (ITGA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3673 (ITGA2)
   04611 Platelet activation
    3673 (ITGA2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    3673 (ITGA2)
   05205 Proteoglycans in cancer
    3673 (ITGA2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    3673 (ITGA2)
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    3673 (ITGA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3673 (ITGA2)
   05414 Dilated cardiomyopathy (DCM)
    3673 (ITGA2)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    3673 (ITGA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3673 (ITGA2)
   04515 Cell adhesion molecules [BR:hsa04515]
    3673 (ITGA2)
   04090 CD molecules [BR:hsa04090]
    3673 (ITGA2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   3673 (ITGA2)
  Exosomal proteins of bladder cancer cells
   3673 (ITGA2)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3673 (ITGA2)
CD molecules [BR:hsa04090]
 Proteins
  3673 (ITGA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS Integrin_alpha HisK_sensor
Motif
Other DBs
NCBI-GeneID: 3673
NCBI-ProteinID: NP_002194
OMIM: 192974
HGNC: 6137
Ensembl: ENSG00000164171
Vega: OTTHUMG00000131165
Pharos: P17301(Tbio)
UniProt: P17301
Structure
PDB: 

Position
5q11.2
AA seq 1181 aa AA seqDB search
MGPERTGAAPLPLLLVLALSQGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKG
NWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLILT
RNMGTGGFLTCGPLWAQQCGNQYYTTGVCSDISPDFQLSASFSPATQPCPSLIDVVVVCD
ESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNLNTYKTKEEMIVATS
QTSQYGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCN
HDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQ
IFSIEGTVQGGDNFQMEMSQVGFSADYSSQNDILMLGAVGAFGWSGTIVQKTSHGHLIFP
KQAFDQILQDRNHSSYLGYSVAAISTGESTHFVAGAPRANYTGQIVLYSVNENGNITVIQ
AHRGDQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMSDLKKEEGRVYLFTIKEGILGQH
QFLEGPEGIENTRFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHQGTIRTKY
SQKILGSDGAFRSHLQYFGRSLDGYGDLNGDSITDVSIGAFGQVVQLWSQSIADVAIEAS
FTPEKITLVNKNAQIILKLCFSAKFRPTKQNNQVAIVYNITLDADGFSSRVTSRGLFKEN
NERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETAKV
FSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTG
IVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQ
NLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSI
VHSFEDVGPKFIFSLKVTTGSVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCN
ADINPLKIGQTSSSVSFKSENFRHTKELNCRTASCSNVTCWLKDVHMKGEYFVNVTTRIW
NGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIIGSII
AGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS
NT seq 3546 nt NT seq  +upstreamnt  +downstreamnt
atggggccagaacggacaggggccgcgccgctgccgctgctgctggtgttagcgctcagt
caaggcattttaaattgttgtttggcctacaatgttggtctcccagaagcaaaaatattt
tccggtccttcaagtgaacagtttggctatgcagtgcagcagtttataaatccaaaaggc
aactggttactggttggttcaccctggagtggctttcctgagaaccgaatgggagatgtg
tataaatgtcctgttgacctatccactgccacatgtgaaaaactaaatttgcaaacttca
acaagcattccaaatgttactgagatgaaaaccaacatgagcctcggcttgatcctcacc
aggaacatgggaactggaggttttctcacatgtggtcctctgtgggcacagcaatgtggg
aatcagtattacacaacgggtgtgtgttctgacatcagtcctgattttcagctctcagcc
agcttctcacctgcaactcagccctgcccttccctcatagatgttgtggttgtgtgtgat
gaatcaaatagtatttatccttgggatgcagtaaagaattttttggaaaaatttgtacaa
ggcctggatataggccccacaaagacacaggtggggttaattcagtatgccaataatcca
agagttgtgtttaacttgaacacatataaaaccaaagaagaaatgattgtagcaacatcc
cagacatcccaatatggtggggacctcacaaacacattcggagcaattcaatatgcaaga
aaatatgcttattcagcagcttctggtgggcgacgaagtgctacgaaagtaatggtagtt
gtaactgacggtgaatcacatgatggttcaatgttgaaagctgtgattgatcaatgcaac
catgacaatatactgaggtttggcatagcagttcttgggtacttaaacagaaacgccctt
gatactaaaaatttaataaaagaaataaaagcaatcgctagtattccaacagaaagatac
tttttcaatgtgtctgatgaagcagctctactagaaaaggctgggacattaggagaacaa
attttcagcattgaaggtactgttcaaggaggagacaactttcagatggaaatgtcacaa
gtgggattcagtgcagattactcttctcaaaatgatattctgatgctgggtgcagtggga
gcttttggctggagtgggaccattgtccagaagacatctcatggccatttgatctttcct
aaacaagcctttgaccaaattctgcaggacagaaatcacagttcatatttaggttactct
gtggctgcaatttctactggagaaagcactcactttgttgctggtgctcctcgggcaaat
tataccggccagatagtgctatatagtgtgaatgagaatggcaatatcacggttattcag
gctcaccgaggtgaccagattggctcctattttggtagtgtgctgtgttcagttgatgtg
gataaagacaccattacagacgtgctcttggtaggtgcaccaatgtacatgagtgaccta
aagaaagaggaaggaagagtctacctgtttactatcaaagagggcattttgggtcagcac
caatttcttgaaggccccgagggcattgaaaacactcgatttggttcagcaattgcagct
ctttcagacatcaacatggatggctttaatgatgtgattgttggttcaccactagaaaat
cagaattctggagctgtatacatttacaatggtcatcagggcactatccgcacaaagtat
tcccagaaaatcttgggatccgatggagcctttaggagccatctccagtactttgggagg
tccttggatggctatggagatttaaatggggattccatcaccgatgtgtctattggtgcc
tttggacaagtggttcaactctggtcacaaagtattgctgatgtagctatagaagcttca
ttcacaccagaaaaaatcactttggtcaacaagaatgctcagataattctcaaactctgc
ttcagtgcaaagttcagacctactaagcaaaacaatcaagtggccattgtatataacatc
acacttgatgcagatggattttcatccagagtaacctccagggggttatttaaagaaaac
aatgaaaggtgcctgcagaagaatatggtagtaaatcaagcacagagttgccccgagcac
atcatttatatacaggagccctctgatgttgtcaactctttggatttgcgtgtggacatc
agtctggaaaaccctggcactagccctgcccttgaagcctattctgagactgccaaggtc
ttcagtattcctttccacaaagactgtggtgaggacggactttgcatttctgatctagtc
ctagatgtccgacaaataccagctgctcaagaacaaccctttattgtcagcaaccaaaac
aaaaggttaacattttcagtaacgctgaaaaataaaagggaaagtgcatacaacactgga
attgttgttgatttttcagaaaacttgttttttgcatcattctccctgccggttgatggg
acagaagtaacatgccaggtggctgcatctcagaagtctgttgcctgcgatgtaggctac
cctgctttaaagagagaacaacaggtgacttttactattaactttgacttcaatcttcaa
aaccttcagaatcaggcgtctctcagtttccaagccttaagtgaaagccaagaagaaaac
aaggctgataatttggtcaacctcaaaattcctctcctgtatgatgctgaaattcactta
acaagatctaccaacataaatttttatgaaatctcttcggatgggaatgttccttcaatc
gtgcacagttttgaagatgttggtccaaaattcatcttctccctgaaggtaacaacagga
agtgttccagtaagcatggcaactgtaatcatccacatccctcagtataccaaagaaaag
aacccactgatgtacctaactggggtgcaaacagacaaggctggtgacatcagttgtaat
gcagatatcaatccactgaaaataggacaaacatcttcttctgtatctttcaaaagtgaa
aatttcaggcacaccaaagaattgaactgcagaactgcttcctgtagtaatgttacctgc
tggttgaaagacgttcacatgaaaggagaatactttgttaatgtgactaccagaatttgg
aacgggactttcgcatcatcaacgttccagacagtacagctaacggcagctgcagaaatc
aacacctataaccctgagatatatgtgattgaagataacactgttacgattcccctgatg
ataatgaaacctgatgagaaagccgaagtaccaacaggagttataataggaagtataatt
gctggaatccttttgctgttagctctggttgcaattttatggaagctcggcttcttcaaa
agaaaatatgaaaagatgaccaaaaatccagatgagattgatgagaccacagagctcagt
agctga

DBGET integrated database retrieval system