KEGG   Homo sapiens (human): 3675Help
Entry
3675              CDS       T01001                                 

Gene name
ITGA3, CD49C, FRP-2, GAP-B3, GAPB3, ILNEB, MSK18, VCA-2, VL3A, VLA3a
Definition
(RefSeq) integrin subunit alpha 3
  KO
K06482  integrin alpha 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04640  Hematopoietic cell lineage
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Network
N00393  ITGA/B-RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3675 (ITGA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3675 (ITGA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3675 (ITGA3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3675 (ITGA3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3675 (ITGA3)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    3675 (ITGA3)
   05222 Small cell lung cancer
    3675 (ITGA3)
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    3675 (ITGA3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3675 (ITGA3)
   05414 Dilated cardiomyopathy (DCM)
    3675 (ITGA3)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    3675 (ITGA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3675 (ITGA3)
   04515 Cell adhesion molecules [BR:hsa04515]
    3675 (ITGA3)
   04090 CD Molecules [BR:hsa04090]
    3675 (ITGA3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3675 (ITGA3)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3675 (ITGA3)
CD molecules [BR:hsa04090]
 Proteins
  3675 (ITGA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS MTABC_N MLANA LYRIC
Motif
Other DBs
NCBI-GeneID: 3675
NCBI-ProteinID: NP_002195
OMIM: 605025
HGNC: 6139
Ensembl: ENSG00000005884
Vega: OTTHUMG00000161890
Pharos: P26006(Tbio)
UniProt: P26006 A0A140VJM0
Position
17q21.33
AA seq 1051 aa AA seqDB search
MGPGPSRAPRAPRLMLCALALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHR
QTERQQRYLLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKNDPGHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDSSDDWQTY
HNEMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKEWDLSEYSYK
DPEDQGNLYIGYTMQVGSFILHPKNITIVTGAPRHRHMGAVFLLSQEAGGDLRRRQVLEG
SQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYVFMNQAGTSFPAHPSLL
LHGPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLLRQPQQVIHGE
KLGLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINIVHKTLVPRPAVL
DPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFH
GFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQA
QALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNT
RTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAF
EVIGVTLHTRDLQVQLQLSTSSHQDNLWPMILTLLVDYTLQTSLSMVNHRLQSFFGGTVM
GESGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITVHG
NGSWPCRPPGDLINPLNLTLSDPGDRPSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSET
VLTCATGRAHCVWLECPIPDAPVVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRT
SIPTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGFFK
RARTRALYEAKRQKAEMKSQPSETERLTDDY
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atgggccccggccccagccgcgcgccccgcgccccacgcctgatgctctgtgcgctcgcc
ttgatggtggcggccggcggctgcgtcgtctccgccttcaacctggatacccgattcctg
gtagtgaaggaggccgggaacccgggcagcctcttcggctactcggtcgccctccatcgg
cagacagagcggcagcagcgctacctgctcctggctggtgccccccgggagctcgctgtg
cccgatggctacaccaaccggactggtgctgtgtacctgtgcccactcactgcccacaag
gatgactgtgagcggatgaacatcacagtgaaaaatgaccctggccatcacattattgag
gacatgtggcttggagtgactgtggccagccagggccctgcaggcagagttctggtctgt
gcccaccgctacacccaggtgctgtggtcagggtcagaagaccagcggcgcatggtgggc
aagtgctacgtgcgaggcaatgacctagagctggactccagtgatgactggcagacctac
cacaacgagatgtgcaatagcaacacagactacctggagacgggcatgtgccagctgggc
accagcggtggcttcacccagaacactgtgtacttcggcgcccccggtgcctacaactgg
aaaggaaacagctacatgattcagcgcaaggagtgggacttatctgagtatagttacaag
gacccagaggaccaaggaaacctctatattgggtacacgatgcaggtaggcagcttcatc
ctgcaccccaaaaacatcaccattgtgacaggtgccccacggcaccgacatatgggcgcg
gtgttcttgctgagccaggaggcaggcggagacctgcggaggaggcaggtgctggagggc
tcgcaggtgggcgcctattttggcagcgccattgccctggcagacctgaacaatgatggg
tggcaggacctcctggtgggcgccccctactacttcgagaggaaagaggaagtagggggt
gccatctatgtcttcatgaaccaggcgggaacctccttccctgctcacccctcactcctt
cttcatggccccagtggctctgcctttggtttatctgtggccagcattggtgacatcaac
caggatggatttcaggatattgctgtgggagctccgtttgaaggcttgggcaaagtgtac
atctatcacagtagctctaaggggctccttagacagccccagcaggtaatccatggagag
aagctgggactgcctgggttggccaccttcggctattccctcagtgggcagatggatgtg
gatgagaacttctacccagaccttctagtgggaagcctgtcagaccacattgtgctgctg
cgggcccggcccgtcatcaacatcgtccacaagaccttggtgcccaggccagctgtgctg
gaccctgcactttgcacggccacctcttgtgtgcaagtggagctgtgctttgcttacaac
cagagtgccgggaaccccaactacaggcgaaacatcaccctggcctacactctggaggct
gacagggaccgccggccgccccggctccgctttgccggcagtgagtccgctgtcttccac
ggcttcttctccatgcccgagatgcgctgccagaagctggagctgctcctgatggacaac
ctccgtgacaaactccgccccatcatcatctccatgaactactctttacctttgcggatg
cccgatcgcccccggctggggctgcggtccctggacgcctacccgatcctcaaccaggca
caggctctggagaaccacactgaggtccagttccagaaggagtgcgggcctgacaacaag
tgtgagagcaacttgcagatgcgggcagccttcgtgtcagagcagcagcagaagctgagc
aggctccagtacagcagagacgtccggaaattgctcctgagcatcaacgtgacgaacacc
cggacctcggagcgctccggggaggacgcccacgaggcgctgctcaccctggtggtgcct
cccgccctgctgctgtcctcagtgcgcccccccggggcctgccaagctaatgagaccatc
ttttgcgagctggggaaccccttcaaacggaaccagaggatggagctgctcatcgccttt
gaggtcatcggggtgaccctgcacacaagggaccttcaggtgcagctgcagctctccacg
tcgagtcaccaggacaacctgtggcccatgatcctcactctgctggtggactatacactc
cagacctcgcttagcatggtaaatcaccggctacaaagcttctttggggggacagtgatg
ggtgagtctggcatgaaaactgtggaggatgtaggaagccccctcaagtatgaattccag
gtgggcccaatgggggaggggctggtgggcctggggaccctggtcctaggtctggagtgg
ccctacgaagtcagcaatggcaagtggctgctgtatcccacggagatcaccgtccatggc
aatgggtcctggccctgccgaccacctggagaccttatcaaccctctcaacctcactctt
tctgaccctggggacaggccatcatccccacagcgcaggcggcgacagctggatccaggg
ggaggccagggccccccacctgtcactctggctgctgccaaaaaagccaagtctgagact
gtgctgacctgtgccacagggcgtgcccactgtgtgtggctagagtgccccatccctgat
gcccccgttgtcaccaacgtgactgtgaaggcacgagtgtggaacagcaccttcatcgag
gattacagagactttgaccgagtccgggtaaatggctgggctaccctattcctccgaacc
agcatccccaccatcaacatggagaacaagaccacgtggttctctgtggacattgactcg
gagctggtggaggagctgccggccgaaatcgagctgtggctggtgctggtggccgtgggt
gcagggctgctgctgctggggctgatcatcctcctgctgtggaagtgcggcttcttcaag
cgagcccgcactcgcgccctgtatgaagctaagaggcagaaggcggagatgaagagccag
ccgtcagagacagagaggctgaccgacgactactga

DBGET integrated database retrieval system