KEGG   Homo sapiens (human): 3678Help
Entry
3678              CDS       T01001                                 

Gene name
ITGA5, CD49e, FNRA, VLA-5, VLA5A
Definition
(RefSeq) integrin subunit alpha 5
  KO
K06484  integrin alpha 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04640  Hematopoietic cell lineage
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
hsa05133  Pertussis
hsa05165  Human papillomavirus infection
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Drug target
Volociximab: D06319
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3678 (ITGA5)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3678 (ITGA5)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3678 (ITGA5)
  Cellular community - eukaryotes
   04510 Focal adhesion
    3678 (ITGA5)
  Cell motility
   04810 Regulation of actin cytoskeleton
    3678 (ITGA5)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3678 (ITGA5)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    3678 (ITGA5)
   05205 Proteoglycans in cancer
    3678 (ITGA5)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    3678 (ITGA5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3678 (ITGA5)
   05414 Dilated cardiomyopathy (DCM)
    3678 (ITGA5)
  Infectious diseases
   05131 Shigellosis
    3678 (ITGA5)
   05133 Pertussis
    3678 (ITGA5)
   05100 Bacterial invasion of epithelial cells
    3678 (ITGA5)
   05165 Human papillomavirus infection
    3678 (ITGA5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3678 (ITGA5)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3678 (ITGA5)
CD molecules [BR:hsa04090]
 Proteins
  3678 (ITGA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Motif
Other DBs
NCBI-GeneID: 3678
NCBI-ProteinID: NP_002196
OMIM: 135620
HGNC: 6141
Ensembl: ENSG00000161638
Vega: OTTHUMG00000169841
Pharos: P08648(Tbio)
UniProt: P08648 B2R627
Structure
PDB: 

Position
12q13.13
AA seq 1049 aa AA seqDB search
MGSRTPESPLHAVQLRWGPRRRPPLLPLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFF
GFSVEFYRPGTDGVSVLVGAPKANTSQPGVLQGGAVYLCPWGASPTQCTPIEFDSKGSRL
LESSLSSSEGEEPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLST
DNFTRILEYAPCRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQ
IAESYYPEYLINLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTY
GYVTILNGSDIRSLYNFSGEQMASYFGYAVAATDVNGDGLDDLLVGAPLLMDRTPDGRPQ
EVGRVYVYLQHPAGIEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGET
QQGVVFVFPGGPGGLGSKPSQVLQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFG
VDKAVVYRGRPIVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVADSI
GFTVELQLDWQKQKGGVRRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDK
LSPIHIALNFSLDPQAPVDSHGLRPALHYQSKSRIEDKAQILLDCGEDNICVPDLQLEVF
GEQNHVYLGDKNALNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNFSSLSCDY
FAVNQSRLLVCDLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSKNLNNSQSDVV
SFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSI
SQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRS
SASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAV
YKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYIL
YKLGFFKRSLPYGTAMEKAQLKPPATSDA
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atggggagccggacgccagagtcccctctccacgccgtgcagctgcgctggggcccccgg
cgccgacccccgctgctgccgctgctgttgctgctgctgccgccgccacccagggtcggg
ggcttcaacttagacgcggaggccccagcagtactctcggggcccccgggctccttcttc
ggattctcagtggagttttaccggccgggaacagacggggtcagtgtgctggtgggagca
cccaaggctaataccagccagccaggagtgctgcagggtggtgctgtctacctctgtcct
tggggtgccagccccacacagtgcacccccattgaatttgacagcaaaggctctcggctc
ctggagtcctcactgtccagctcagagggagaggagcctgtggagtacaagtccttgcag
tggttcggggcaacagttcgagcccatggctcctccatcttggcatgcgctccactgtac
agctggcgcacagagaaggagccactgagcgaccccgtgggcacctgctacctctccaca
gataacttcacccgaattctggagtatgcaccctgccgctcagatttcagctgggcagca
ggacagggttactgccaaggaggcttcagtgccgagttcaccaagactggccgtgtggtt
ttaggtggaccaggaagctatttctggcaaggccagatcctgtctgccactcaggagcag
attgcagaatcttattaccccgagtacctgatcaacctggttcaggggcagctgcagact
cgccaggccagttccatctatgatgacagctacctaggatactctgtggctgttggtgaa
ttcagtggtgatgacacagaagactttgttgctggtgtgcccaaagggaacctcacttac
ggctatgtcaccatccttaatggctcagacattcgatccctctacaacttctcaggggaa
cagatggcctcctactttggctatgcagtggccgccacagacgtcaatggggacgggctg
gatgacttgctggtgggggcacccctgctcatggatcggacccctgacgggcggcctcag
gaggtgggcagggtctacgtctacctgcagcacccagccggcatagagcccacgcccacc
cttaccctcactggccatgatgagtttggccgatttggcagctccttgacccccctgggg
gacctggaccaggatggctacaatgatgtggccatcggggctccctttggtggggagacc
cagcagggagtagtgtttgtatttcctgggggcccaggagggctgggctctaagccttcc
caggttctgcagcccctgtgggcagccagccacaccccagacttctttggctctgccctt
cgaggaggccgagacctggatggcaatggatatcctgatctgattgtggggtcctttggt
gtggacaaggctgtggtatacaggggccgccccatcgtgtccgctagtgcctccctcacc
atcttccccgccatgttcaacccagaggagcggagctgcagcttagaggggaaccctgtg
gcctgcatcaaccttagcttctgcctcaatgcttctggaaaacacgttgctgactccatt
ggtttcacagtggaacttcagctggactggcagaagcagaagggaggggtacggcgggca
ctgttcctggcctccaggcaggcaaccctgacccagaccctgctcatccagaatggggct
cgagaggattgcagagagatgaagatctacctcaggaacgagtcagaatttcgagacaaa
ctctcgccgattcacatcgctctcaacttctccttggacccccaagccccagtggacagc
cacggcctcaggccagccctacattatcagagcaagagccggatagaggacaaggctcag
atcttgctggactgtggagaagacaacatctgtgtgcctgacctgcagctggaagtgttt
ggggagcagaaccatgtgtacctgggtgacaagaatgccctgaacctcactttccatgcc
cagaatgtgggtgagggtggcgcctatgaggctgagcttcgggtcaccgcccctccagag
gctgagtactcaggactcgtcagacacccagggaacttctccagcctgagctgtgactac
tttgccgtgaaccagagccgcctgctggtgtgtgacctgggcaaccccatgaaggcagga
gccagtctgtggggtggccttcggtttacagtccctcatctccgggacactaagaaaacc
atccagtttgacttccagatcctcagcaagaatctcaacaactcgcaaagcgacgtggtt
tcctttcggctctccgtggaggctcaggcccaggtcaccctgaacggtgtctccaagcct
gaggcagtgctattcccagtaagcgactggcatccccgagaccagcctcagaaggaggag
gacctgggacctgctgtccaccatgtctatgagctcatcaaccaaggccccagctccatt
agccagggtgtgctggaactcagctgtccccaggctctggaaggtcagcagctcctatat
gtgaccagagttacgggactcaactgcaccaccaatcaccccattaacccaaagggcctg
gagttggatcccgagggttccctgcaccaccagcaaaaacgggaagctccaagccgcagc
tctgcttcctcgggacctcagatcctgaaatgcccggaggctgagtgtttcaggctgcgc
tgtgagctcgggcccctgcaccaacaagagagccaaagtctgcagttgcatttccgagtc
tgggccaagactttcttgcagcgggagcaccagccatttagcctgcagtgtgaggctgtg
tacaaagccctgaagatgccctaccgaatcctgcctcggcagctgccccaaaaagagcgt
caggtggccacagctgtgcaatggaccaaggcagaaggcagctatggcgtcccactgtgg
atcatcatcctagccatcctgtttggcctcctgctcctaggtctactcatctacatcctc
tacaagcttggattcttcaaacgctccctcccatatggcaccgccatggaaaaagctcag
ctcaagcctccagccacctctgatgcctga

DBGET integrated database retrieval system