KEGG   Homo sapiens (human): 3682Help
Entry
3682              CDS       T01001                                 

Gene name
ITGAE, CD103, HUMINAE
Definition
(RefSeq) integrin subunit alpha E
  KO
K06524  integrin alpha E
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3682 (ITGAE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    3682 (ITGAE)
   04090 CD Molecules [BR:hsa04090]
    3682 (ITGAE)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3682 (ITGAE)
CD molecules [BR:hsa04090]
 Proteins
  3682 (ITGAE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 VCBS Integrin_alpha
Motif
Other DBs
NCBI-GeneID: 3682
NCBI-ProteinID: NP_002199
OMIM: 604682
HGNC: 6147
Ensembl: ENSG00000083457
Vega: OTTHUMG00000177634
Pharos: P38570(Tbio)
UniProt: P38570
Position
17p13.2
AA seq 1179 aa AA seqDB search
MWLFHTLLCIASLALLAAFNVDVARPWLTPKGGAPFVLSSLLHQDPSTNQTWLLVTSPRT
KRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSS
ELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDVNTARQRRAL
EKEEEEDKEEEEDEEEEEAGTEIAIILDGSGSIDPPDFQRAKDFISNMMRNFYEKCFECN
FALVQYGGVIQTEFDLRDSQDVMASLARVQNITQVGSVTKTASAMQHVLDSIFTSSHGSR
RKASKVMVVLTDGGIFEDPLNLTTVINSPKMQGVERFAIGVGEEFKSARTARELNLIASD
PDETHAFKVTNYMALDGLLSKLRYNIISMEGTVGDALHYQLAQIGFSAQILDERQVLLGA
VGAFDWSGGALLYDTRSRRGRFLNQTAAAAADAEAAQYSYLGYAVAVLHKTCSLSYIAGA
PRYKHHGAVFELQKEGREASFLPVLEGEQMGSYFGSELCPVDIDMDGSTDFLLVAAPFYH
VHGEEGRVYVYRLSEQDGSFSLARILSGHPGFTNARFGFAMAAMGDLSQDKLTDVAIGAP
LEGFGADDGASFGSVYIYNGHWDGLSASPSQRIRASTVAPGLQYFGMSMAGGFDISGDGL
ADITVGTLGQAVVFRSRPVVRLKVSMAFTPSALPIGFNGVVNVRLCFEISSVTTASESGL
REALLNFTLDVDVGKQRRRLQCSDVRSCLGCLREWSSGSQLCEDLLLMPTEGELCEEDCF
SNASVKVSYQLQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVS
QQELVVGLTKELTLNINLTNSGEDSYMTSMALNYPRNLQLKRMQKPPSPNIQCDDPQPVA
SVLIMNCRIGHPVLKRSSAHVSVVWQLEENAFPNRTADITVTVTNSNERRSLANETHTLQ
FRHGFVAVLSKPSIMYVNTGQGLSHHKEFLFHVHGENLFGAEYQLQICVPTKLRGLQVVA
VKKLTRTQASTVCTWSQERACAYSSVQHVEEWHSVSCVIASDKENVTVAAEISWDHSEEL
LKDVTELQILGEISFNKSLYEGLNAENHRTKITVVFLKDEKYHSLPIIIKGSVGGLLVLI
VILVILFKCGFFKRKYQQLNLESIRKAQLKSENLLEEEN
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcttccacactctgctctgcatagccagcctggccctgctggccgctttcaat
gtggatgtggcccggccctggctcacgcccaagggaggtgcccctttcgtgctcagctcc
cttctgcaccaagaccccagcaccaaccagacctggctcctggtcaccagccccagaacc
aagaggacaccagggcccctccatcgatgttcccttgtccaggatgaaatcctttgccat
cctgtagagcatgtccccatccccaaggggaggcaccggggagtgaccgttgtccggagc
caccacggtgttttgatatgcattcaagtgctggtccggcggcctcacagcctcagctca
gaactcacaggcacctgtagcctcctgggccctgacctccgtccccaggctcaggccaac
ttcttcgaccttgaaaatctcctggatccagatgcacgtgtggacactggagactgctac
agcaacaaagaaggcggtggagaagacgatgtgaacacagccaggcagcgccgggctctg
gagaaggaggaggaggaagacaaggaggaggaggaagacgaggaggaggaggaagctggc
accgagattgccatcatcctggatggctcaggaagcattgatcccccagactttcagaga
gccaaagacttcatctccaacatgatgaggaacttctatgaaaagtgttttgagtgcaac
tttgccttggtgcagtatggaggagtgatccagactgagtttgaccttcgggacagccag
gatgtgatggcctccctcgccagagtccagaacatcactcaagtggggagtgtcaccaag
actgcctcagccatgcaacacgtcttagacagcatcttcacctcaagccacggctccagg
agaaaggcatccaaggtcatggtggtgctcaccgatggtggcatattcgaggaccccctc
aaccttacgacagtcatcaactcccccaaaatgcagggtgttgagcgctttgccattggg
gtgggagaagaatttaagagtgctaggactgcgagggaactgaacctgatcgcctcagac
ccggatgagacccatgctttcaaggtgaccaactacatggcgctggatgggctgctgagc
aaactgcggtacaacatcatcagcatggaaggcacggttggagacgcccttcactaccag
ctggcacagattggcttcagtgctcagatcctggatgagcggcaggtgctgctcggcgcc
gtcggggcctttgactggtccggaggggcgttgctctacgacacacgcagccgccggggc
cgcttcctgaaccagacagcggcggcggcggcagacgcggaggctgcgcagtacagctac
ctgggttacgctgtggccgtgctgcacaagacctgcagcctctcctacatcgcgggggct
ccacggtacaaacatcatggggccgtgtttgagctccagaaggagggcagagaggccagc
ttcctgccagtgctggagggagagcagatggggtcctattttggctctgagctgtgccct
gtggacattgacatggatggaagcacggacttcttgctggtggctgctccattttaccac
gttcatggagaagaaggcagagtctacgtgtaccgtctcagcgagcaggatggttctttc
tccttggcacgcatactgagtgggcaccccgggttcaccaatgcccgctttggctttgcc
atggcggctatgggggatctcagtcaggataagctcacagatgtggccatcggggccccc
ctggaaggttttggggcagatgatggtgccagcttcggcagtgtgtatatctacaatgga
cactgggacggcctctccgccagcccctcgcagcggatcagagcctccacggtggcccca
ggactccagtacttcggcatgtccatggctggtggctttgatattagtggcgacggcctt
gccgacatcaccgtgggcactctgggccaggcggttgtgttccgctcccggcctgtggtt
cgcctgaaggtctccatggccttcacccccagcgcactgcccatcggcttcaacggcgtc
gtgaatgtccgtttatgttttgaaatcagctctgtaaccacagcctctgagtcaggcctc
cgcgaggcacttctcaacttcacgctggatgtggatgtggggaagcagaggagacggctg
cagtgttcagacgtaagaagctgtctgggctgcctgagggagtggagcagcggatcccag
ctttgtgaggacctcctgctcatgcccacagagggagagctctgtgaggaggactgcttc
tccaatgccagtgtcaaagtcagctaccagctccagacccctgagggacagacggaccat
ccccagcccatcctggaccgctacactgagccctttgccatcttccagctgccctatgag
aaggcctgcaagaataagctgttttgtgtcgcagaattacagttggccaccaccgtctct
cagcaggagttggtggtgggtctcacaaaggagctgaccctgaacattaacctaactaac
tccggggaagattcctacatgacaagcatggccttgaattaccccagaaacctgcagttg
aagaggatgcaaaagcctccctctccaaacattcagtgtgatgaccctcagccggttgct
tctgtcctgatcatgaactgcaggattggtcaccccgtcctcaagaggtcatctgctcat
gtttcagtcgtttggcagctagaggagaatgcctttccaaacaggacagcagacatcact
gtgactgtcaccaattccaatgaaagacggtctttggccaacgagacccacacccttcaa
ttcaggcatggcttcgttgcagttctgtccaaaccatccataatgtacgtgaacacaggc
caggggctttctcaccacaaagaattcctcttccatgtacatggggagaacctctttgga
gcagaataccagttgcaaatttgcgtcccaaccaaattacgaggtctccaggttgtagca
gtgaagaagctgacgaggactcaggcctccacggtgtgcacctggagtcaggagcgcgct
tgtgcgtacagttcggttcagcatgtggaagaatggcattcagtgagctgtgtcatcgct
tcagataaagaaaatgtcaccgtggctgcagagatctcctgggatcactctgaggagtta
ctaaaagatgtaactgaactgcagatccttggtgaaatatctttcaacaaatctctatat
gagggactgaatgcagagaaccacagaactaagatcactgtcgtcttcctgaaagatgag
aagtaccattctttgcctatcatcattaaaggcagcgttggtggacttctggtgttgatc
gtgattctggtcatcctgttcaagtgtggcttttttaaaagaaaatatcaacaactgaac
ttggagagcatcaggaaggcccagctgaaatcagagaatctgctcgaagaagagaattag

DBGET integrated database retrieval system