KEGG   Homo sapiens (human): 3684Help
Entry
3684              CDS       T01001                                 

Gene name
ITGAM, CD11B, CR3A, MAC-1, MAC1A, MO1A, SLEB6
Definition
(RefSeq) integrin subunit alpha M
  KO
K06461  integrin alpha M
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules (CAMs)
hsa04610  Complement and coagulation cascades
hsa04640  Hematopoietic cell lineage
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05146  Amoebiasis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
nt06136  Complement activation (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00112  AML1-ETO fusion to PU.1-mediated transcription
N00463  Alternative pathway of complement activation
Drug target
Rovelizumab: D08993
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    3684 (ITGAM)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3684 (ITGAM)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3684 (ITGAM)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3684 (ITGAM)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3684 (ITGAM)
   04610 Complement and coagulation cascades
    3684 (ITGAM)
   04670 Leukocyte transendothelial migration
    3684 (ITGAM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    3684 (ITGAM)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    3684 (ITGAM)
  09171 Infectious disease: bacterial
   05133 Pertussis
    3684 (ITGAM)
   05134 Legionellosis
    3684 (ITGAM)
   05150 Staphylococcus aureus infection
    3684 (ITGAM)
   05152 Tuberculosis
    3684 (ITGAM)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3684 (ITGAM)
   05140 Leishmaniasis
    3684 (ITGAM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3684 (ITGAM)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3684 (ITGAM)
   04515 Cell adhesion molecules [BR:hsa04515]
    3684 (ITGAM)
   04090 CD molecules [BR:hsa04090]
    3684 (ITGAM)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3684 (ITGAM)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    3684 (ITGAM)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3684 (ITGAM)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3684 (ITGAM)
CD molecules [BR:hsa04090]
 Proteins
  3684 (ITGAM)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Adhesion molecules of cell surface
   3684 (ITGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 Integrin_alpha VCBS FG-GAP_2
Motif
Other DBs
NCBI-GeneID: 3684
NCBI-ProteinID: NP_000623
OMIM: 120980
HGNC: 6149
Ensembl: ENSG00000169896
Vega: OTTHUMG00000176612
Pharos: P11215(Tbio)
UniProt: P11215
Structure
PDB: 

Position
16p11.2
AA seq 1152 aa AA seqDB search
MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQR
GSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVK
GLCFLFGSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQL
KKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFN
ITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQEL
NTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEMSQEGFSAAIT
SNGPLLSTVGSYDWAGGVFLYTSKEKSTFINMTRVDSDMNDAYLGYAAAIILRNRVQSLV
LGAPRYQHIGLVAMFRQNTGMWESNANVKGTQIGAYFGASLCSVDVDSNGSTDLVLIGAP
HYYEQTRGGQVSVCPLPRGRARWQCDAVLYGEQGQPWGRFGAALTVLGDVNGDKLTDVAI
GAPGEEDNRGAVYLFHGTSGSGISPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVD
LTVGAQGHVLLLRSQPVLRVKAIMEFNPREVARNVFECNDQVVKGKEAGEVRVCLHVQKS
TRDRLREGQIQSVVTYDLALDSGRPHSRAVFNETKNSTRRQTQVLGLTQTCETLKLQLPN
CIEDPVSPIVLRLNFSLVGTPLSAFGNLRPVLAEDAQRLFTALFPFEKNCGNDNICQDDL
SITFSFMSLDCLVVGGPREFNVTVTVRNDGEDSYRTQVTFFFPLDLSYRKVSTLQNQRSQ
RSWRLACESASSTEVSGALKSTSCSINHPIFPENSEVTFNITFDVDSKASLGNKLLLKAN
VTSENNMPRTNKTEFQLELPVKYAVYMVVTSHGVSTKYLNFTASENTSRVMQHQYQVSNL
GQRSLPISLVFLVPVRLNQTVIWDRPQVTFSENLSSTCHTKERLPSHSDFLAELRKAPVV
NCSIAVCQRIQCDIPFFGIQEEFNATLKGNLSFDWYIKTSHNHLLIVSTAEILFNDSVFT
LLPGQGAFVRSQTETKVEPFEVPNPLPLIVGSSVGGLLLLALITAALYKLGFFKRQYKDM
MSEGGPPGAEPQ
NT seq 3459 nt NT seq  +upstreamnt  +downstreamnt
atggctctcagagtccttctgttaacagccttgaccttatgtcatgggttcaacttggac
actgaaaacgcaatgaccttccaagagaacgcaaggggcttcgggcagagcgtggtccag
cttcagggatccagggtggtggttggagccccccaggagatagtggctgccaaccaaagg
ggcagcctctaccagtgcgactacagcacaggctcatgcgagcccatccgcctgcaggtc
cccgtggaggccgtgaacatgtccctgggcctgtccctggcagccaccaccagcccccct
cagctgctggcctgtggtcccaccgtgcaccagacttgcagtgagaacacgtatgtgaaa
gggctctgcttcctgtttggatccaacctacggcagcagccccagaagttcccagaggcc
ctccgagggtgtcctcaagaggatagtgacattgccttcttgattgatggctctggtagc
atcatcccacatgactttcggcggatgaaggagtttgtctcaactgtgatggagcaatta
aaaaagtccaaaaccttgttctctttgatgcagtactctgaagaattccggattcacttt
accttcaaagagttccagaacaaccctaacccaagatcactggtgaagccaataacgcag
ctgcttgggcggacacacacggccacgggcatccgcaaagtggtacgagagctgtttaac
atcaccaacggagcccgaaagaatgcctttaagatcctagttgtcatcacggatggagaa
aagtttggcgatcccttgggatatgaggatgtcatccctgaggcagacagagagggagtc
attcgctacgtcattggggtgggagatgccttccgcagtgagaaatcccgccaagagctt
aataccatcgcatccaagccgcctcgtgatcacgtgttccaggtgaataactttgaggct
ctgaagaccattcagaaccagcttcgggagaagatctttgcgatcgagggtactcagaca
ggaagtagcagctcctttgagcatgagatgtctcaggaaggcttcagcgctgccatcacc
tctaatggccccttgctgagcactgtggggagctatgactgggctggtggagtctttcta
tatacatcaaaggagaaaagcaccttcatcaacatgaccagagtggattcagacatgaat
gatgcttacttgggttatgctgccgccatcatcttacggaaccgggtgcaaagcctggtt
ctgggggcacctcgatatcagcacatcggcctggtagcgatgttcaggcagaacactggc
atgtgggagtccaacgctaatgtcaagggcacccagatcggcgcctacttcggggcctcc
ctctgctccgtggacgtggacagcaacggcagcaccgacctggtcctcatcggggccccc
cattactacgagcagacccgagggggccaggtgtccgtgtgccccttgcccagggggagg
gctcggtggcagtgtgatgctgttctctacggggagcagggccaaccctggggccgcttt
ggggcagccctaacagtgctgggggacgtaaatggggacaagctgacggacgtggccatt
ggggccccaggagaggaggacaaccggggtgctgtttacctgtttcacggaacctcagga
tctggcatcagcccctcccatagccagcggatagcaggctccaagctctctcccaggctc
cagtattttggtcagtcactgagtgggggccaggacctcacaatggatggactggtagac
ctgactgtaggagcccaggggcacgtgctgctgctcaggtcccagccagtactgagagtc
aaggcaatcatggagttcaatcccagggaagtggcaaggaatgtatttgagtgtaatgat
caggtggtgaaaggcaaggaagccggagaggtcagagtctgcctccatgtccagaagagc
acacgggatcggctaagagaaggacagatccagagtgttgtgacttatgacctggctctg
gactccggccgcccacattcccgcgccgtcttcaatgagacaaagaacagcacacgcaga
cagacacaggtcttggggctgacccagacttgtgagaccctgaaactacagttgccgaat
tgcatcgaggacccagtgagccccattgtgctgcgcctgaacttctctctggtgggaacg
ccattgtctgctttcgggaacctccggccagtgctggcggaggatgctcagagactcttc
acagccttgtttccctttgagaagaattgtggcaatgacaacatctgccaggatgacctc
agcatcaccttcagtttcatgagcctggactgcctcgtggtgggtgggccccgggagttc
aacgtgacagtgactgtgagaaatgatggtgaggactcctacaggacacaggtcaccttc
ttcttcccgcttgacctgtcctaccggaaggtgtccacgctccagaaccagcgctcacag
cgatcctggcgcctggcctgtgagtctgcctcctccaccgaagtgtctggggccttgaag
agcaccagctgcagcataaaccaccccatcttcccggaaaactcagaggtcacctttaat
atcacgtttgatgtagactctaaggcttcccttggaaacaaactgctcctcaaggccaat
gtgaccagtgagaacaacatgcccagaaccaacaaaaccgaattccaactggagctgccg
gtgaaatatgctgtctacatggtggtcaccagccatggggtctccactaaatatctcaac
ttcacggcctcagagaataccagtcgggtcatgcagcatcaatatcaggtcagcaacctg
gggcagaggagcctccccatcagcctggtgttcttggtgcccgtccggctgaaccagact
gtcatatgggaccgcccccaggtcaccttctccgagaacctctcgagtacgtgccacacc
aaggagcgcttgccctctcactccgactttctggctgagcttcggaaggcccccgtggtg
aactgctccatcgctgtctgccagagaatccagtgtgacatcccgttctttggcatccag
gaagaattcaatgctaccctcaaaggcaacctctcgtttgactggtacatcaagacctcg
cataaccacctcctgatcgtgagcacagctgagatcttgtttaacgattccgtgttcacc
ctgctgccgggacagggggcgtttgtgaggtcccagacggagaccaaagtggagccgttc
gaggtccccaaccccctgccgctcatcgtgggcagctctgtcgggggactgctgctcctg
gccctcatcaccgccgcgctgtacaagctcggcttcttcaagcggcaatacaaggacatg
atgagtgaagggggtcccccgggggccgaaccccagtag

KEGG   Homo sapiens (human): 3689Help
Entry
3689              CDS       T01001                                 

Gene name
ITGB2, CD18, LAD, LCAMB, LFA-1, MAC-1, MF17, MFI7
Definition
(RefSeq) integrin subunit beta 2
  KO
K06464  integrin beta 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04145  Phagosome
hsa04390  Hippo signaling pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04610  Complement and coagulation cascades
hsa04650  Natural killer cell mediated cytotoxicity
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05144  Malaria
hsa05146  Amoebiasis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05166  Human T-cell leukemia virus 1 infection
hsa05323  Rheumatoid arthritis
hsa05416  Viral myocarditis
Network
nt06136  Complement activation (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00463  Alternative pathway of complement activation
Disease
H00099  Leukocyte adhesion deficiency
Drug target
Erlizumab: D04045
Rovelizumab: D08993
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    3689 (ITGB2)
   04390 Hippo signaling pathway
    3689 (ITGB2)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3689 (ITGB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3689 (ITGB2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3689 (ITGB2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    3689 (ITGB2)
   04650 Natural killer cell mediated cytotoxicity
    3689 (ITGB2)
   04670 Leukocyte transendothelial migration
    3689 (ITGB2)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    3689 (ITGB2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3689 (ITGB2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    3689 (ITGB2)
   05134 Legionellosis
    3689 (ITGB2)
   05150 Staphylococcus aureus infection
    3689 (ITGB2)
   05152 Tuberculosis
    3689 (ITGB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3689 (ITGB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3689 (ITGB2)
   05144 Malaria
    3689 (ITGB2)
   05140 Leishmaniasis
    3689 (ITGB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3689 (ITGB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3689 (ITGB2)
   04515 Cell adhesion molecules [BR:hsa04515]
    3689 (ITGB2)
   04090 CD molecules [BR:hsa04090]
    3689 (ITGB2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    3689 (ITGB2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3689 (ITGB2)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin beta subunits
   3689 (ITGB2)
CD molecules [BR:hsa04090]
 Proteins
  3689 (ITGB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt PSI_integrin I-EGF_1 EGF_2
Motif
Other DBs
NCBI-GeneID: 3689
NCBI-ProteinID: NP_000202
OMIM: 600065
HGNC: 6155
Ensembl: ENSG00000160255
Vega: OTTHUMG00000090257
Pharos: P05107(Tclin)
UniProt: P05107
Structure
PDB: 

Position
21q22.3
AA seq 769 aa AA seqDB search
MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSI
RCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFR
RAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFV
NTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAM
MQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFD
YPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIKNAY
NKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATEC
IQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKN
CECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTIN
CERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNV
CECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGR
TCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPNIAAIVGGTVAGIVLIGILLL
VIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcctgcgccccccactgctcgccctggtggggctgctctccctcgggtgcgtc
ctctctcaggagtgcacgaagttcaaggtcagcagctgccgggaatgcatcgagtcgggg
cccggctgcacctggtgccagaagctgaacttcacagggccgggggatcctgactccatt
cgctgcgacacccggccacagctgctcatgaggggctgtgcggctgacgacatcatggac
cccacaagcctcgctgaaacccaggaagaccacaatgggggccagaagcagctgtcccca
caaaaagtgacgctttacctgcgaccaggccaggcagcagcgttcaacgtgaccttccgg
cgggccaagggctaccccatcgacctgtactatctgatggacctctcctactccatgctt
gatgacctcaggaatgtcaagaagctaggtggcgacctgctccgggccctcaacgagatc
accgagtccggccgcattggcttcgggtccttcgtggacaagaccgtgctgccgttcgtg
aacacgcaccctgataagctgcgaaacccatgccccaacaaggagaaagagtgccagccc
ccgtttgccttcaggcacgtgctgaagctgaccaacaactccaaccagtttcagaccgag
gtcgggaagcagctgatttccggaaacctggatgcacccgagggtgggctggacgccatg
atgcaggtcgccgcctgcccggaggaaatcggctggcgcaacgtcacgcggctgctggtg
tttgccactgatgacggcttccatttcgcgggcgacgggaagctgggcgccatcctgacc
cccaacgacggccgctgtcacctggaggacaacttgtacaagaggagcaacgaattcgac
tacccatcggtgggccagctggcgcacaagctggctgaaaacaacatccagcccatcttc
gcggtgaccagtaggatggtgaagacctacgagaaactcaccgagatcatccccaagtca
gccgtgggggagctgtctgaggactccagcaatgtggtccatctcattaagaatgcttac
aataaactctcctccagggtcttcctggatcacaacgccctccccgacaccctgaaagtc
acctacgactccttctgcagcaatggagtgacgcacaggaaccagcccagaggtgactgt
gatggcgtgcagatcaatgtcccgatcaccttccaggtgaaggtcacggccacagagtgc
atccaggagcagtcgtttgtcatccgggcgctgggcttcacggacatagtgaccgtgcag
gttcttccccagtgtgagtgccggtgccgggaccagagcagagaccgcagcctctgccat
ggcaagggcttcttggagtgcggcatctgcaggtgtgacactggctacattgggaaaaac
tgtgagtgccagacacagggccggagcagccaggagctggaaggaagctgccggaaggac
aacaactccatcatctgctcagggctgggggactgtgtctgcgggcagtgcctgtgccac
accagcgacgtccccggcaagctgatatacgggcagtactgcgagtgtgacaccatcaac
tgtgagcgctacaacggccaggtctgcggcggcccggggagggggctctgcttctgcggg
aagtgccgctgccacccgggctttgagggctcagcgtgccagtgcgagaggaccactgag
ggctgcctgaacccgcggcgtgttgagtgtagtggtcgtggccggtgccgctgcaacgta
tgcgagtgccattcaggctaccagctgcctctgtgccaggagtgccccggctgcccctca
ccctgtggcaagtacatctcctgcgccgagtgcctgaagttcgaaaagggcccctttggg
aagaactgcagcgcggcgtgtccgggcctgcagctgtcgaacaaccccgtgaagggcagg
acctgcaaggagagggactcagagggctgctgggtggcctacacgctggagcagcaggac
gggatggaccgctacctcatctatgtggatgagagccgagagtgtgtggcaggccccaac
atcgccgccatcgtcgggggcaccgtggcaggcatcgtgctgatcggcattctcctgctg
gtcatctggaaggctctgatccacctgagcgacctccgggagtacaggcgctttgagaag
gagaagctcaagtcccagtggaacaatgataatccccttttcaagagcgccaccacgacg
gtcatgaaccccaagtttgctgagagttag

DBGET integrated database retrieval system