KEGG   Homo sapiens (human): 3688Help
Entry
3688              CDS       T01001                                 

Gene name
ITGB1, CD29, FNRB, GPIIA, MDF2, MSK12, VLA-BETA, VLAB
Definition
(RefSeq) integrin subunit beta 1
  KO
K05719  integrin beta 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04611  Platelet activation
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05133  Pertussis
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05222  Small cell lung cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Drug target
Valategrast hydrochloride: D10028
Volociximab: D06319
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    3688 (ITGB1)
   04151 PI3K-Akt signaling pathway
    3688 (ITGB1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    3688 (ITGB1)
   04514 Cell adhesion molecules (CAMs)
    3688 (ITGB1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    3688 (ITGB1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    3688 (ITGB1)
   04530 Tight junction
    3688 (ITGB1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    3688 (ITGB1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    3688 (ITGB1)
   04670 Leukocyte transendothelial migration
    3688 (ITGB1)
  Development
   04360 Axon guidance
    3688 (ITGB1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3688 (ITGB1)
   05205 Proteoglycans in cancer
    3688 (ITGB1)
   05222 Small cell lung cancer
    3688 (ITGB1)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    3688 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3688 (ITGB1)
   05414 Dilated cardiomyopathy (DCM)
    3688 (ITGB1)
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    3688 (ITGB1)
   05131 Shigellosis
    3688 (ITGB1)
   05133 Pertussis
    3688 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    3688 (ITGB1)
   05165 Human papillomavirus infection
    3688 (ITGB1)
   05145 Toxoplasmosis
    3688 (ITGB1)
   05140 Leishmaniasis
    3688 (ITGB1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    3688 (ITGB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3688 (ITGB1)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin beta subunits
   3688 (ITGB1)
CD molecules [BR:hsa04090]
 Proteins
  3688 (ITGB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin EGF_2
Motif
Other DBs
NCBI-GeneID: 3688
NCBI-ProteinID: NP_002202
OMIM: 135630
HGNC: 6153
Ensembl: ENSG00000150093
Vega: OTTHUMG00000017928
Pharos: P05556(Tclin)
UniProt: P05556
Structure
PDB: 

Position
10p11.22
AA seq 798 aa AA seqDB search
MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLV
LRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE
ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVEN
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacaaccaattttctggattggactgatcagttcagtttgctgtgtgtttgct
caaacagatgaaaatagatgtttaaaagcaaatgccaaatcatgtggagaatgtatacaa
gcagggccaaattgtgggtggtgcacaaattcaacatttttacaggaaggaatgcctact
tctgcacgatgtgatgatttagaagccttaaaaaagaagggttgccctccagatgacata
gaaaatcccagaggctccaaagatataaagaaaaataaaaatgtaaccaaccgtagcaaa
ggaacagcagagaagctcaagccagaggatattactcagatccaaccacagcagttggtt
ttgcgattaagatcaggggagccacagacatttacattaaaattcaagagagctgaagac
tatcccattgacctctactaccttatggacctgtcttactcaatgaaagacgatttggag
aatgtaaaaagtcttggaacagatctgatgaatgaaatgaggaggattacttcggacttc
agaattggatttggctcatttgtggaaaagactgtgatgccttacattagcacaacacca
gctaagctcaggaacccttgcacaagtgaacagaactgcaccagcccatttagctacaaa
aatgtgctcagtcttactaataaaggagaagtatttaatgaacttgttggaaaacagcgc
atatctggaaatttggattctccagaaggtggtttcgatgccatcatgcaagttgcagtt
tgtggatcactgattggctggaggaatgttacacggctgctggtgttttccacagatgcc
gggtttcactttgctggagatgggaaacttggtggcattgttttaccaaatgatggacaa
tgtcacctggaaaataatatgtacacaatgagccattattatgattatccttctattgct
caccttgtccagaaactgagtgaaaataatattcagacaatttttgcagttactgaagaa
tttcagcctgtttacaaggagctgaaaaacttgatccctaagtcagcagtaggaacatta
tctgcaaattctagcaatgtaattcagttgatcattgatgcatacaattccctttcctca
gaagtcattttggaaaacggcaaattgtcagaaggcgtaacaataagttacaaatcttac
tgcaagaacggggtgaatggaacaggggaaaatggaagaaaatgttccaatatttccatt
ggagatgaggttcaatttgaaattagcataacttcaaataagtgtccaaaaaaggattct
gacagctttaaaattaggcctctgggctttacggaggaagtagaggttattcttcagtac
atctgtgaatgtgaatgccaaagcgaaggcatccctgaaagtcccaagtgtcatgaagga
aatgggacatttgagtgtggcgcgtgcaggtgcaatgaagggcgtgttggtagacattgt
gaatgcagcacagatgaagttaacagtgaagacatggatgcttactgcaggaaagaaaac
agttcagaaatctgcagtaacaatggagagtgcgtctgcggacagtgtgtttgtaggaag
agggataatacaaatgaaatttattctggcaaattctgcgagtgtgataatttcaactgt
gatagatccaatggcttaatttgtggaggaaatggtgtttgcaagtgtcgtgtgtgtgag
tgcaaccccaactacactggcagtgcatgtgactgttctttggatactagtacttgtgaa
gccagcaacggacagatctgcaatggccggggcatctgcgagtgtggtgtctgtaagtgt
acagatccgaagtttcaagggcaaacgtgtgagatgtgtcagacctgccttggtgtctgt
gctgagcataaagaatgtgttcagtgcagagccttcaataaaggagaaaagaaagacaca
tgcacacaggaatgttcctattttaacattaccaaggtagaaagtcgggacaaattaccc
cagccggtccaacctgatcctgtgtcccattgtaaggagaaggatgttgacgactgttgg
ttctattttacgtattcagtgaatgggaacaacgaggtcatggttcatgttgtggagaat
ccagagtgtcccactggtccagacatcattccaattgtagctggtgtggttgctggaatt
gttcttattggccttgcattactgctgatatggaagcttttaatgataattcatgacaga
agggagtttgctaaatttgaaaaggagaaaatgaatgccaaatgggacacgggtgaaaat
cctatttataagagtgccgtaacaactgtggtcaatccgaagtatgagggaaaatga

DBGET integrated database retrieval system