KEGG   Homo sapiens (human): 3688Help
Entry
3688              CDS       T01001                                 

Gene name
ITGB1, CD29, FNRB, GPIIA, MDF2, MSK12, VLA-BETA, VLAB
Definition
(RefSeq) integrin subunit beta 1
  KO
K05719  integrin beta 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04611  Platelet activation
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05222  Small cell lung cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06135  Cytoskeletal regulation (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoA signaling pathway
Drug target
Valategrast hydrochloride: D10028
Volociximab: D06319
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    3688 (ITGB1)
   04151 PI3K-Akt signaling pathway
    3688 (ITGB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3688 (ITGB1)
   04514 Cell adhesion molecules (CAMs)
    3688 (ITGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3688 (ITGB1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3688 (ITGB1)
   04530 Tight junction
    3688 (ITGB1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3688 (ITGB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    3688 (ITGB1)
   04670 Leukocyte transendothelial migration
    3688 (ITGB1)
  09158 Development and regeneration
   04360 Axon guidance
    3688 (ITGB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3688 (ITGB1)
   05205 Proteoglycans in cancer
    3688 (ITGB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    3688 (ITGB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    3688 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3688 (ITGB1)
   05414 Dilated cardiomyopathy (DCM)
    3688 (ITGB1)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    3688 (ITGB1)
   05131 Shigellosis
    3688 (ITGB1)
   05135 Yersinia infection
    3688 (ITGB1)
   05133 Pertussis
    3688 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    3688 (ITGB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3688 (ITGB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3688 (ITGB1)
   05140 Leishmaniasis
    3688 (ITGB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3688 (ITGB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3688 (ITGB1)
   04515 Cell adhesion molecules [BR:hsa04515]
    3688 (ITGB1)
   04090 CD molecules [BR:hsa04090]
    3688 (ITGB1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    3688 (ITGB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3688 (ITGB1)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin beta subunits
   3688 (ITGB1)
CD molecules [BR:hsa04090]
 Proteins
  3688 (ITGB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2
Motif
Other DBs
NCBI-GeneID: 3688
NCBI-ProteinID: NP_002202
OMIM: 135630
HGNC: 6153
Ensembl: ENSG00000150093
Vega: OTTHUMG00000017928
Pharos: P05556(Tclin)
UniProt: P05556
Structure
PDB: 

Position
10p11.22
AA seq 798 aa AA seqDB search
MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLV
LRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE
ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVEN
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacaaccaattttctggattggactgatcagttcagtttgctgtgtgtttgct
caaacagatgaaaatagatgtttaaaagcaaatgccaaatcatgtggagaatgtatacaa
gcagggccaaattgtgggtggtgcacaaattcaacatttttacaggaaggaatgcctact
tctgcacgatgtgatgatttagaagccttaaaaaagaagggttgccctccagatgacata
gaaaatcccagaggctccaaagatataaagaaaaataaaaatgtaaccaaccgtagcaaa
ggaacagcagagaagctcaagccagaggatattactcagatccaaccacagcagttggtt
ttgcgattaagatcaggggagccacagacatttacattaaaattcaagagagctgaagac
tatcccattgacctctactaccttatggacctgtcttactcaatgaaagacgatttggag
aatgtaaaaagtcttggaacagatctgatgaatgaaatgaggaggattacttcggacttc
agaattggatttggctcatttgtggaaaagactgtgatgccttacattagcacaacacca
gctaagctcaggaacccttgcacaagtgaacagaactgcaccagcccatttagctacaaa
aatgtgctcagtcttactaataaaggagaagtatttaatgaacttgttggaaaacagcgc
atatctggaaatttggattctccagaaggtggtttcgatgccatcatgcaagttgcagtt
tgtggatcactgattggctggaggaatgttacacggctgctggtgttttccacagatgcc
gggtttcactttgctggagatgggaaacttggtggcattgttttaccaaatgatggacaa
tgtcacctggaaaataatatgtacacaatgagccattattatgattatccttctattgct
caccttgtccagaaactgagtgaaaataatattcagacaatttttgcagttactgaagaa
tttcagcctgtttacaaggagctgaaaaacttgatccctaagtcagcagtaggaacatta
tctgcaaattctagcaatgtaattcagttgatcattgatgcatacaattccctttcctca
gaagtcattttggaaaacggcaaattgtcagaaggcgtaacaataagttacaaatcttac
tgcaagaacggggtgaatggaacaggggaaaatggaagaaaatgttccaatatttccatt
ggagatgaggttcaatttgaaattagcataacttcaaataagtgtccaaaaaaggattct
gacagctttaaaattaggcctctgggctttacggaggaagtagaggttattcttcagtac
atctgtgaatgtgaatgccaaagcgaaggcatccctgaaagtcccaagtgtcatgaagga
aatgggacatttgagtgtggcgcgtgcaggtgcaatgaagggcgtgttggtagacattgt
gaatgcagcacagatgaagttaacagtgaagacatggatgcttactgcaggaaagaaaac
agttcagaaatctgcagtaacaatggagagtgcgtctgcggacagtgtgtttgtaggaag
agggataatacaaatgaaatttattctggcaaattctgcgagtgtgataatttcaactgt
gatagatccaatggcttaatttgtggaggaaatggtgtttgcaagtgtcgtgtgtgtgag
tgcaaccccaactacactggcagtgcatgtgactgttctttggatactagtacttgtgaa
gccagcaacggacagatctgcaatggccggggcatctgcgagtgtggtgtctgtaagtgt
acagatccgaagtttcaagggcaaacgtgtgagatgtgtcagacctgccttggtgtctgt
gctgagcataaagaatgtgttcagtgcagagccttcaataaaggagaaaagaaagacaca
tgcacacaggaatgttcctattttaacattaccaaggtagaaagtcgggacaaattaccc
cagccggtccaacctgatcctgtgtcccattgtaaggagaaggatgttgacgactgttgg
ttctattttacgtattcagtgaatgggaacaacgaggtcatggttcatgttgtggagaat
ccagagtgtcccactggtccagacatcattccaattgtagctggtgtggttgctggaatt
gttcttattggccttgcattactgctgatatggaagcttttaatgataattcatgacaga
agggagtttgctaaatttgaaaaggagaaaatgaatgccaaatgggacacgggtgaaaat
cctatttataagagtgccgtaacaactgtggtcaatccgaagtatgagggaaaatga

KEGG   Homo sapiens (human): 3690Help
Entry
3690              CDS       T01001                                 

Gene name
ITGB3, BDPLT16, BDPLT2, CD61, GP3A, GPIIIa, GT
Definition
(RefSeq) integrin subunit beta 3
  KO
K06493  integrin beta 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04611  Platelet activation
hsa04640  Hematopoietic cell lineage
hsa04810  Regulation of actin cytoskeleton
hsa04919  Thyroid hormone signaling pathway
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06135  Cytoskeletal regulation (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoA signaling pathway
N00394  HCMV gH to ITGA/B-RhoA signaling pathway
Disease
H00083  Allograft rejection
H00226  Glanzmann thrombasthenia
H01740  Macrothrombocytopenia
Drug target
Abciximab: D02778
Cilengitide: D03497
Elarofiban: D03971
Eptifibatide: D06888
Etaracizumab: D09342
Fluciclatide F 18: D09903
Lamifiban (DG01420): D04659 D04660
Lotrafiban hydrochloride: D04785
Maraciclatide: D09929
Orbofiban acetate: D05267
Roxifiban acetate: D05772
Sibrafiban: D05834
Tadocizumab: D06649
Tirofiban (DG00159): D01029 D08607
Xemilofiban hydrochloride: D06335
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    3690 (ITGB3)
   04151 PI3K-Akt signaling pathway
    3690 (ITGB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3690 (ITGB3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3690 (ITGB3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3690 (ITGB3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3690 (ITGB3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3690 (ITGB3)
   04611 Platelet activation
    3690 (ITGB3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    3690 (ITGB3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    3690 (ITGB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    3690 (ITGB3)
   05205 Proteoglycans in cancer
    3690 (ITGB3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    3690 (ITGB3)
   05410 Hypertrophic cardiomyopathy (HCM)
    3690 (ITGB3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3690 (ITGB3)
   05414 Dilated cardiomyopathy (DCM)
    3690 (ITGB3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    3690 (ITGB3)
   05163 Human cytomegalovirus infection
    3690 (ITGB3)
   05165 Human papillomavirus infection
    3690 (ITGB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3690 (ITGB3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3690 (ITGB3)
   04515 Cell adhesion molecules [BR:hsa04515]
    3690 (ITGB3)
   04090 CD molecules [BR:hsa04090]
    3690 (ITGB3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    3690 (ITGB3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3690 (ITGB3)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin beta subunits
   3690 (ITGB3)
CD molecules [BR:hsa04090]
 Proteins
  3690 (ITGB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2
Motif
Other DBs
NCBI-GeneID: 3690
NCBI-ProteinID: NP_000203
OMIM: 173470
HGNC: 6156
Ensembl: ENSG00000259207
Vega: OTTHUMG00000171956
Pharos: P05106(Tclin)
UniProt: P05106
Structure
PDB: 

Position
17q21.32
AA seq 788 aa AA seqDB search
MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLG
SPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRP
DDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFG
AFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSR
NRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCH
VGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLS
MDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDT
VSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGT
FECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFG
KITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLL
CSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRY
CRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDIL
VVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTF
TNITYRGT
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcgcggccgcggccccggccgctctgggcgactgtgctggcgctgggggcgctg
gcgggcgttggcgtaggagggcccaacatctgtaccacgcgaggtgtgagctcctgccag
cagtgcctggctgtgagccccatgtgtgcctggtgctctgatgaggccctgcctctgggc
tcacctcgctgtgacctgaaggagaatctgctgaaggataactgtgccccagaatccatc
gagttcccagtgagtgaggcccgagtactagaggacaggcccctcagcgacaagggctct
ggagacagctcccaggtcactcaagtcagtccccagaggattgcactccggctccggcca
gatgattcgaagaatttctccatccaagtgcggcaggtggaggattaccctgtggacatc
tactacttgatggacctgtcttactccatgaaggatgatctgtggagcatccagaacctg
ggtaccaagctggccacccagatgcgaaagctcaccagtaacctgcggattggcttcggg
gcatttgtggacaagcctgtgtcaccatacatgtatatctccccaccagaggccctcgaa
aacccctgctatgatatgaagaccacctgcttgcccatgtttggctacaaacacgtgctg
acgctaactgaccaggtgacccgcttcaatgaggaagtgaagaagcagagtgtgtcacgg
aaccgagatgccccagagggtggctttgatgccatcatgcaggctacagtctgtgatgaa
aagattggctggaggaatgatgcatcccacttgctggtgtttaccactgatgccaagact
catatagcattggacggaaggctggcaggcattgtccagcctaatgacgggcagtgtcat
gttggtagtgacaatcattactctgcctccactaccatggattatccctctttggggctg
atgactgagaagctatcccagaaaaacatcaatttgatctttgcagtgactgaaaatgta
gtcaatctctatcagaactatagtgagctcatcccagggaccacagttggggttctgtcc
atggattccagcaatgtcctccagctcattgttgatgcttatgggaaaatccgttctaaa
gtagagctggaagtgcgtgacctccctgaagagttgtctctatccttcaatgccacctgc
ctcaacaatgaggtcatccctggcctcaagtcttgtatgggactcaagattggagacacg
gtgagcttcagcattgaggccaaggtgcgaggctgtccccaggagaaggagaagtccttt
accataaagcccgtgggcttcaaggacagcctgatcgtccaggtcacctttgattgtgac
tgtgcctgccaggcccaagctgaacctaatagccatcgctgcaacaatggcaatgggacc
tttgagtgtggggtatgccgttgtgggcctggctggctgggatcccagtgtgagtgctca
gaggaggactatcgcccttcccagcaggacgaatgcagcccccgggagggtcagcccgtc
tgcagccagcggggcgagtgcctctgtggtcaatgtgtctgccacagcagtgactttggc
aagatcacgggcaagtactgcgagtgtgacgacttctcctgtgtccgctacaagggggag
atgtgctcaggccatggccagtgcagctgtggggactgcctgtgtgactccgactggacc
ggctactactgcaactgtaccacgcgtactgacacctgcatgtccagcaatgggctgctg
tgcagcggccgcggcaagtgtgaatgtggcagctgtgtctgtatccagccgggctcctat
ggggacacctgtgagaagtgccccacctgcccagatgcctgcacctttaagaaagaatgt
gtggagtgtaagaagtttgaccggggagccctacatgacgaaaatacctgcaaccgttac
tgccgtgacgagattgagtcagtgaaagagcttaaggacactggcaaggatgcagtgaat
tgtacctataagaatgaggatgactgtgtcgtcagattccagtactatgaagattctagt
ggaaagtccatcctgtatgtggtagaagagccagagtgtcccaagggccctgacatcctg
gtggtcctgctctcagtgatgggggccattctgctcattggccttgccgccctgctcatc
tggaaactcctcatcaccatccacgaccgaaaagaattcgctaaatttgaggaagaacgc
gccagagcaaaatgggacacagccaacaacccactgtataaagaggccacgtctaccttc
accaatatcacgtaccggggcacttaa

KEGG   Homo sapiens (human): 3691Help
Entry
3691              CDS       T01001                                 

Gene name
ITGB4, CD104, GP150
Definition
(RefSeq) integrin subunit beta 4
  KO
K06525  integrin beta 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06135  Cytoskeletal regulation (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoA signaling pathway
Disease
H00586  Epidermolysis bullosa, junctional
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3691 (ITGB4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3691 (ITGB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3691 (ITGB4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3691 (ITGB4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    3691 (ITGB4)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3691 (ITGB4)
   05414 Dilated cardiomyopathy (DCM)
    3691 (ITGB4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3691 (ITGB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3691 (ITGB4)
   04515 Cell adhesion molecules [BR:hsa04515]
    3691 (ITGB4)
   04090 CD molecules [BR:hsa04090]
    3691 (ITGB4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   3691 (ITGB4)
  Exosomal proteins of bladder cancer cells
   3691 (ITGB4)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin beta subunits
   3691 (ITGB4)
CD molecules [BR:hsa04090]
 Proteins
  3691 (ITGB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta fn3 Calx-beta Integrin_B_tail I-EGF_1 PSI_integrin Pur_ac_phosph_N EGF_2 SEA
Motif
Other DBs
NCBI-GeneID: 3691
NCBI-ProteinID: NP_000204
OMIM: 147557
HGNC: 6158
Ensembl: ENSG00000132470
Vega: OTTHUMG00000179814
Pharos: P16144(Tbio)
UniProt: P16144 A0A024R8T0
Structure
PDB: 

Position
17q25.1
AA seq 1822 aa AA seqDB search
MAGPRPSPWARLLLAALISVSLSGTLANRCKKAPVKSCTECVRVDKDCAYCTDEMFRDRR
CNTQAELLAAGCQRESIVVMESSFQITEETQIDTTLRRSQMSPQGLRVRLRPGEERHFEL
EVFEPLESPVDLYILMDFSNSMSDDLDNLKKMGQNLARVLSQLTSDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTEDVDEFRNKLQGERISGNLDAPEGGFDAIL
QTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGIMSRNDERCHLDTTGTYTQYR
TQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSSNIVELLE
EAFNRIRSNLDIRALDSPRGLRTEVTSKMFQKTRTGSFHIRRGEVGIYQVQLRALEHVDG
THVCQLPEDQKGNIHLKPSFSDGLKMDAGIICDVCTCELQKEVRSARCSFNGDFVCGQCV
CSEGWSGQTCNCSTGSLSDIQPCLREGEDKPCSGRGECQCGHCVCYGEGRYEGQFCEYDN
FQCPRTSGFLCNDRGRCSMGQCVCEPGWTGPSCDCPLSNATCIDSNGGICNGRGHCECGR
CHCHQQSLYTDTICEINYSAIHPGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMVDE
LKRAEEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLVHKKKDCPPGSFWWLIPLLLL
LLPLLALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMASDHLDTPMLR
SGNLKGRDVVRWKVTNNMQRPGFATHAASINPTELVPYGLSLRLARLCTENLLKPDTREC
AQLRQEVEENLNEVYRQISGVHKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKPALLK
LTEKQVEQRAFHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQL
LVEAIDVPAGTATLGRRLVNITIIKEQARDVVSFEQPEFSVSRGDQVARIPVIRRVLDGG
KSQVSYRTQDGTAQGNRDYIPVEGELLFQPGEAWKELQVKLLELQEVDSLLRGRQVRRFH
VQLSNPKFGAHLGQPHSTTIIIRDPDELDRSFTSQMLSSQPPPHGDLGAPQNPNAKAAGS
RKIHFNWLPPSGKPMGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAYG
AQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLV
NDDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQP
KRPMSIPIIPDIPIVDAQSGEDYDSFLMYSDDVLRSPSGSQRPSVSDDTGCGWKFEPLLG
EELDLRRVTWRLPPELIPRLSASSGRSSDAEAPHGPPDDGGAGGKGGSLPRSATPGPPGE
HLVNGRMDFAFPGSTNSLHRMTTTSAAAYGTHLSPHVPHRVLSTSSTLTRDYNSLTRSEH
SHSTTLPRDYSTLTSVSSHDSRLTAGVPDTPTRLVFSALGPTSLRVSWQEPRCERPLQGY
SVEYQLLNGGELHRLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIES
QVHPQSPLCPLPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDIVGYLVTCEM
AQGGGPATAFRVDGDSPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDGG
PFPQLGSRAGLFQHPLQSEYSSITTTHTSATEPFLVDGLTLGAQHLEAGGSLTRHVTQEF
VSRTLTTSGTLSTHMDQQFFQT
NT seq 5469 nt NT seq  +upstreamnt  +downstreamnt
atggcagggccacgccccagcccatgggccaggctgctcctggcagccttgatcagcgtc
agcctctctgggaccttggcaaaccgctgcaagaaggccccagtgaagagctgcacggag
tgtgtccgtgtggataaggactgcgcctactgcacagacgagatgttcagggaccggcgc
tgcaacacccaggcggagctgctggccgcgggctgccagcgggagagcatcgtggtcatg
gagagcagcttccaaatcacagaggagacccagattgacaccaccctgcggcgcagccag
atgtccccccaaggcctgcgggtccgtctgcggcccggtgaggagcggcattttgagctg
gaggtgtttgagccactggagagccccgtggacctgtacatcctcatggacttctccaac
tccatgtccgatgatctggacaacctcaagaagatggggcagaacctggctcgggtcctg
agccagctcaccagcgactacactattggatttggcaagtttgtggacaaagtcagcgtc
ccgcagacggacatgaggcctgagaagctgaaggagccctggcccaacagtgaccccccc
ttctccttcaagaacgtcatcagcctgacagaagatgtggatgagttccggaataaactg
cagggagagcggatctcaggcaacctggatgctcctgagggcggcttcgatgccatcctg
cagacagctgtgtgcacgagggacattggctggcgcccggacagcacccacctgctggtc
ttctccaccgagtcagccttccactatgaggctgatggcgccaacgtgctggctggcatc
atgagccgcaacgatgaacggtgccacctggacaccacgggcacctacacccagtacagg
acacaggactacccgtcggtgcccaccctggtgcgcctgctcgccaagcacaacatcatc
cccatctttgctgtcaccaactactcctatagctactacgagaagcttcacacctatttc
cctgtctcctcactgggggtgctgcaggaggactcgtccaacatcgtggagctgctggag
gaggccttcaatcggatccgctccaacctggacatccgggccctagacagcccccgaggc
cttcggacagaggtcacctccaagatgttccagaagacgaggactgggtcctttcacatc
cggcggggggaagtgggtatataccaggtgcagctgcgggcccttgagcacgtggatggg
acgcacgtgtgccagctgccggaggaccagaagggcaacatccatctgaaaccttccttc
tccgacggcctcaagatggacgcgggcatcatctgtgatgtgtgcacctgcgagctgcaa
aaagaggtgcggtcagctcgctgcagcttcaacggagacttcgtgtgcggacagtgtgtg
tgcagcgagggctggagtggccagacctgcaactgctccaccggctctctgagtgacatt
cagccctgcctgcgggagggcgaggacaagccgtgctccggccgtggggagtgccagtgc
gggcactgtgtgtgctacggcgaaggccgctacgagggtcagttctgcgagtatgacaac
ttccagtgtccccgcacttccgggttcctctgcaatgaccgaggacgctgctccatgggc
cagtgtgtgtgtgagcctggttggacaggcccaagctgtgactgtcccctcagcaatgcc
acctgcatcgacagcaatgggggcatctgtaatggacgtggccactgtgagtgtggccgc
tgccactgccaccagcagtcgctctacacggacaccatctgcgagatcaactactcggcg
atccacccgggcctctgcgaggacctacgctcctgcgtgcagtgccaggcgtggggcacc
ggcgagaagaaggggcgcacgtgtgaggaatgcaacttcaaggtcaagatggtggacgag
cttaagagagccgaggaggtggtggtgcgctgctccttccgggacgaggatgacgactgc
acctacagctacaccatggaaggtgacggcgcccctgggcccaacagcactgtcctggtg
cacaagaagaaggactgccctccgggctccttctggtggctcatccccctgctcctcctc
ctcctgccgctcctggccctgctactgctgctatgctggaagtactgtgcctgctgcaag
gcctgcctggcacttctcccgtgctgcaaccgaggtcacatggtgggctttaaggaagac
cactacatgctgcgggagaacctgatggcctctgaccacttggacacgcccatgctgcgc
agcgggaacctcaagggccgtgacgtggtccgctggaaggtcaccaacaacatgcagcgg
cctggctttgccactcatgccgccagcatcaaccccacagagctggtgccctacgggctg
tccttgcgcctggcccgcctttgcaccgagaacctgctgaagcctgacactcgggagtgc
gcccagctgcgccaggaggtggaggagaacctgaacgaggtctacaggcagatctccggt
gtacacaagctccagcagaccaagttccggcagcagcccaatgccgggaaaaagcaagac
cacaccattgtggacacagtgctgatggcgccccgctcggccaagccggccctgctgaag
cttacagagaagcaggtggaacagagggccttccacgacctcaaggtggcccccggctac
tacaccctcactgcagaccaggacgcccggggcatggtggagttccaggagggcgtggag
ctggtggacgtacgggtgcccctctttatccggcctgaggatgacgacgagaagcagctg
ctggtggaggccatcgacgtgcccgcaggcactgccaccctcggccgccgcctggtaaac
atcaccatcatcaaggagcaagccagagacgtggtgtcctttgagcagcctgagttctcg
gtcagccgcggggaccaggtggcccgcatccctgtcatccggcgtgtcctggacggcggg
aagtcccaggtctcctaccgcacacaggatggcaccgcgcagggcaaccgggactacatc
cccgtggagggtgagctgctgttccagcctggggaggcctggaaagagctgcaggtgaag
ctcctggagctgcaagaagttgactccctcctgcggggccgccaggtccgccgtttccac
gtccagctcagcaaccctaagtttggggcccacctgggccagccccactccaccaccatc
atcatcagggacccagatgaactggaccggagcttcacgagtcagatgttgtcatcacag
ccaccccctcacggcgacctgggcgccccgcagaaccccaatgctaaggccgctgggtcc
aggaagatccatttcaactggctgcccccttctggcaagccaatggggtacagggtaaag
tactggattcagggtgactccgaatccgaagcccacctgctcgacagcaaggtgccctca
gtggagctcaccaacctgtacccgtattgcgactatgagatgaaggtgtgcgcctacggg
gctcagggcgagggaccctacagctccctggtgtcctgccgcacccaccaggaagtgccc
agcgagccagggcgtctggccttcaatgtcgtctcctccacggtgacccagctgagctgg
gctgagccggctgagaccaacggtgagatcacagcctacgaggtctgctatggcctggtc
aacgatgacaaccgacctattgggcccatgaagaaagtgctggttgacaaccctaagaac
cggatgctgcttattgagaaccttcgggagtcccagccctaccgctacacggtgaaggcg
cgcaacggggccggctgggggcctgagcgggaggccatcatcaacctggccacccagccc
aagaggcccatgtccatccccatcatccctgacatccctatcgtggacgcccagagcggg
gaggactacgacagcttccttatgtacagcgatgacgttctacgctctccatcgggcagc
cagaggcccagcgtctccgatgacactggctgcggctggaagttcgagcccctgctgggg
gaggagctggacctgcggcgcgtcacgtggcggctgcccccggagctcatcccgcgcctg
tcggccagcagcgggcgctcctccgacgccgaggcgccccacgggcccccggacgacggc
ggcgcgggcgggaagggcggcagcctgccccgcagtgcgacacccgggccccccggagag
cacctggtgaatggccggatggactttgccttcccgggcagcaccaactccctgcacagg
atgaccacgaccagtgctgctgcctatggcacccacctgagcccacacgtgccccaccgc
gtgctaagcacatcctccaccctcacacgggactacaactcactgacccgctcagaacac
tcacactcgaccacactgcccagggactactccaccctcacctccgtctcctcccacgac
tctcgcctgactgctggtgtgcccgacacgcccacccgcctggtgttctctgccctgggg
cccacatctctcagagtgagctggcaggagccgcggtgcgagcggccgctgcagggctac
agtgtggagtaccagctgctgaacggcggtgagctgcatcggctcaacatccccaaccct
gcccagacctcggtggtggtggaagacctcctgcccaaccactcctacgtgttccgcgtg
cgggcccagagccaggaaggctggggccgagagcgtgagggtgtcatcaccattgaatcc
caggtgcacccgcagagcccactgtgtcccctgccaggctccgccttcactttgagcact
cccagtgccccaggcccgctggtgttcactgccctgagcccagactcgctgcagctgagc
tgggagcggccacggaggcccaatggggatatcgtcggctacctggtgacctgtgagatg
gcccaaggaggagggccagccaccgcattccgggtggatggagacagccccgagagccgg
ctgaccgtgccgggcctcagcgagaacgtgccctacaagttcaaggtgcaggccaggacc
actgagggcttcgggccagagcgcgagggcatcatcaccatagagtcccaggatggagga
cccttcccgcagctgggcagccgtgccgggctcttccagcacccgctgcaaagcgagtac
agcagcatcaccaccacccacaccagcgccaccgagcccttcctagtggatgggctgacc
ctgggggcccagcacctggaggcaggcggctccctcacccggcatgtgacccaggagttt
gtgagccggacactgaccaccagcggaacccttagcacccacatggaccaacagttcttc
caaacttga

KEGG   Homo sapiens (human): 3693Help
Entry
3693              CDS       T01001                                 

Gene name
ITGB5
Definition
(RefSeq) integrin subunit beta 5
  KO
K06588  integrin beta 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05205  Proteoglycans in cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06135  Cytoskeletal regulation (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoA signaling pathway
Drug target
Cilengitide: D03497
Fluciclatide F 18: D09903
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3693 (ITGB5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3693 (ITGB5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3693 (ITGB5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3693 (ITGB5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3693 (ITGB5)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    3693 (ITGB5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    3693 (ITGB5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3693 (ITGB5)
   05414 Dilated cardiomyopathy (DCM)
    3693 (ITGB5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3693 (ITGB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3693 (ITGB5)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    3693 (ITGB5)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    3693 (ITGB5)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin beta subunits
   3693 (ITGB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2 DUF2975
Motif
Other DBs
NCBI-GeneID: 3693
NCBI-ProteinID: NP_002204
OMIM: 147561
HGNC: 6160
Ensembl: ENSG00000082781
Vega: OTTHUMG00000159432
Pharos: P18084(Tbio)
UniProt: P18084 L7RT22
Position
3q21.2
AA seq 799 aa AA seqDB search
MPRAPAPLYACLLGLCALLPRLAGLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSI
TSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRP
GDKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFG
SFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVS
RNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQC
HLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEIL
DGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGD
TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSG
TYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREAEGKPLCSGRGDCSCNQCSCFESEF
GKIYGPFCECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRGRDGQ
ICSERGHCLCGQCQCTEPGAFGEMCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSL
CRDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFTYVELPSGKSNLTVLREPECGNTPNA
MTILLAVVGSILLVGLALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPIST
HTVDFTFNKFNKSYNGTVD
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgggccccggcgccgctgtacgcctgcctcctggggctctgcgcgctcctgccc
cggctcgcaggtctcaacatatgcactagtggaagtgccacctcatgtgaagaatgtctg
ctaatccacccaaaatgtgcctggtgctccaaagaggacttcggaagcccacggtccatc
acctctcggtgtgatctgagggcaaaccttgtcaaaaatggctgtggaggtgagatagag
agcccagccagcagcttccatgtcctgaggagcctgcccctcagcagcaagggttcgggc
tctgcaggctgggacgtcattcagatgacaccacaggagattgccgtgaacctccggccc
ggtgacaagaccaccttccagctacaggttcgccaggtggaggactatcctgtggacctg
tactacctgatggacctctccctgtccatgaaggatgacttggacaatatccggagcctg
ggcaccaaactcgcggaggagatgaggaagctcaccagcaacttccggttgggatttggg
tcttttgttgataaggacatctctcctttctcctacacggcaccgaggtaccagaccaat
ccgtgcattggttacaagttgtttccaaattgcgtcccctcctttgggttccgccatctg
ctgcctctcacagacagagtggacagcttcaatgaggaagttcggaaacagagggtgtcc
cggaaccgagatgcccctgaggggggctttgatgcagtactccaggcagccgtctgcaag
gagaagattggctggcgaaaggatgcactgcatttgctggtgttcacaacagatgatgtg
ccccacatcgcattggatggaaaattgggaggcctggtgcagccacacgatggccagtgc
cacctgaacgaggccaacgagtacactgcatccaaccagatggactatccatcccttgcc
ttgcttggagagaaattggcagagaacaacatcaacctcatctttgcagtgacaaaaaac
cattatatgctgtacaagaattttacagccctgatacctggaacaacggtggagatttta
gatggagactccaaaaatattattcaactgattattaatgcatacaatagtatccggtct
aaagtggagttgtcagtctgggatcagcctgaggatcttaatctcttctttactgctacc
tgccaagatggggtatcctatcctggtcagaggaagtgtgagggtctgaagattggggac
acggcatcttttgaagtatcattggaggcccgaagctgtcccagcagacacacggagcat
gtgtttgccctgcggccggtgggattccgggacagcctggaggtgggggtcacctacaac
tgcacgtgcggctgcagcgtggggctggaacccaacagcgccaggtgcaacgggagcggg
acctatgtctgcggcctgtgtgagtgcagccccggctacctgggcaccaggtgcgagtgc
caggatggggagaaccagagcgtgtaccagaacctgtgccgggaggcagagggcaagcca
ctgtgcagcgggcgtggggactgcagctgcaaccagtgctcctgcttcgagagcgagttt
ggcaagatctatgggcctttctgtgagtgcgacaacttctcctgtgccaggaacaaggga
gtcctctgctcaggccatggcgagtgtcactgcggggaatgcaagtgccatgcaggttac
atcggggacaactgtaactgctcgacagacatcagcacatgccggggcagagatggccag
atctgcagcgagcgtgggcactgtctctgtgggcagtgccaatgcacggagccgggggcc
tttggggagatgtgtgagaagtgccccacctgcccggatgcatgcagcaccaagagagat
tgcgtcgagtgcctgctgctccactctgggaaacctgacaaccagacctgccacagccta
tgcagggatgaggtgatcacatgggtggacaccatcgtgaaagatgaccaggaggctgtg
ctatgtttctacaaaaccgccaaggactgcgtcatgatgttcacctatgtggagctcccc
agtgggaagtccaacctgaccgtcctcagggagccagagtgtggaaacacccccaacgcc
atgaccatcctcctggctgtggtcggtagcatcctccttgttgggcttgcactcctggct
atctggaagctgcttgtcaccatccacgaccggagggagtttgcaaagtttcagagcgag
cgatccagggcccgctatgaaatggcttcaaatccattatacagaaagcctatctccacg
cacactgtggacttcaccttcaacaagttcaacaaatcctacaatggcactgtggactga

KEGG   Homo sapiens (human): 3694Help
Entry
3694              CDS       T01001                                 

Gene name
ITGB6, AI1H
Definition
(RefSeq) integrin subunit beta 6
  KO
K06589  integrin beta 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06135  Cytoskeletal regulation (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoA signaling pathway
Disease
H00615  Amelogenesis imperfecta
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3694 (ITGB6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3694 (ITGB6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3694 (ITGB6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3694 (ITGB6)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    3694 (ITGB6)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3694 (ITGB6)
   05414 Dilated cardiomyopathy (DCM)
    3694 (ITGB6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3694 (ITGB6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3694 (ITGB6)
   04515 Cell adhesion molecules [BR:hsa04515]
    3694 (ITGB6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3694 (ITGB6)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin beta subunits
   3694 (ITGB6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Motif
Other DBs
NCBI-GeneID: 3694
NCBI-ProteinID: NP_000879
OMIM: 147558
HGNC: 6161
Ensembl: ENSG00000115221
Vega: OTTHUMG00000132026
Pharos: P18564(Tbio)
UniProt: P18564
Structure
PDB: 

Position
2q24.2
AA seq 788 aa AA seqDB search
MGIELLCLFFLFLGRNDHVQGGCALGGAETCEDCLLIGPQCAWCAQENFTHPSGVGERCD
TPANLLAKGCQLNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQT
LQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEK
PVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFSVT
VNIPHCERRSRHIIIKPVGLGDALELLVSPECNCDCQKEVEVNSSKCHHGNGSFQCGVCA
CHPGHMGPRCECGEDMLSTDSCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCD
NFSCVRHKGLLCGGNGDCDCGECVCRSGWTGEYCNCTTSTDSCVSEDGVLCSGRGDCVCG
KCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEE
DFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSINEKDCPKPPNIPMIMLGVSLAIL
LIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQ
KVDLSTDC
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggggattgaactgctttgcctgttctttctatttctaggaaggaatgatcacgtacaa
ggtggctgtgccctgggaggtgcagaaacctgtgaagactgcctgcttattggacctcag
tgtgcctggtgtgctcaggagaattttactcatccatctggagttggcgaaaggtgtgat
accccagcaaaccttttagctaaaggatgtcaattaaacttcatcgaaaaccctgtctcc
caagtagaaatacttaaaaataagcctctcagtgtaggcagacagaaaaatagttctgac
attgttcagattgcgcctcaaagcttgatccttaagttgagaccaggtggtgcgcagact
ctgcaggtgcatgtccgccagactgaggactacccggtggatttgtattacctcatggac
ctctccgcctccatggatgacgacctcaacacaataaaggagctgggctcccggctttcc
aaagagatgtctaaattaaccagcaactttagactgggcttcggatcttttgtggaaaaa
cctgtatccccttttgtgaaaacaacaccagaagaaattgccaacccttgcagtagtatt
ccatacttctgtttacctacatttggattcaagcacattttgccattgacaaatgatgct
gaaagattcaatgaaattgtgaagaatcagaaaatttctgctaatattgacacacccgaa
ggtggatttgatgcaattatgcaagctgctgtgtgtaaggaaaaaattggctggcggaat
gactccctccacctcctggtctttgtgagtgatgctgattctcattttggaatggacagc
aaactagcaggcatcgtcattcctaatgacgggctctgtcacttggacagcaagaatgaa
tactccatgtcaactgtcttggaatatccaacaattggacaactcattgataaactggta
caaaacaacgtgttattgatcttcgctgtaacccaagaacaagttcatttatatgagaat
tacgcaaaacttattcctggagctacagtaggtctacttcagaaggactccggaaacatt
ctccagctgatcatctcagcttatgaagaactgcggtctgaggtggaactggaagtatta
ggagacactgaaggactcaacttgtcatttacagccatctgtaacaacggtaccctcttc
caacaccaaaagaaatgctctcacatgaaagtgggagacacagcttccttcagcgtgact
gtgaatatcccacactgcgagagaagaagcaggcacattatcataaagcctgtggggctg
ggggatgccctggaattacttgtcagcccagaatgcaactgcgactgtcagaaagaagtg
gaagtgaacagctccaaatgtcaccacgggaacggctctttccagtgtggggtgtgtgcc
tgccaccctggccacatggggcctcgctgtgagtgtggcgaggacatgctgagcacagat
tcctgcaaggaggccccagatcatccctcctgcagcggaaggggtgactgctactgtggg
cagtgtatctgccacttgtctccctatggaaacatttatgggccttattgccagtgtgac
aatttctcctgcgtgagacacaaagggctgctctgcggaggtaacggcgactgtgactgt
ggtgaatgtgtgtgcaggagcggctggactggcgagtactgcaactgcaccaccagcacg
gactcctgcgtctctgaagatggagtgctctgcagcgggcgcggggactgtgtttgtggc
aagtgtgtttgcacaaaccctggagcctcaggaccaacctgtgaacgatgtcctacctgt
ggtgacccctgtaactctaaacggagctgcattgagtgccacctgtcagcagctggccaa
gcccgagaagaatgtgtggacaagtgcaaactagctggtgcgaccatcagtgaagaagaa
gatttctcaaaggatggttctgtttcctgctctctgcaaggagaaaatgaatgtcttatt
acattcctaataactacagataatgaggggaaaaccatcattcacagcatcaatgaaaaa
gattgtccgaagcctccaaacattcccatgatcatgttaggggtttccctggctattctt
ctcatcggggttgtcctactgtgcatctggaagctactggtgtcatttcatgatcgtaaa
gaagttgccaaatttgaagcagaacgatcaaaagccaagtggcaaacgggaaccaatcca
ctctacagaggatccacaagtacttttaaaaatgtaacttataaacacagggaaaaacaa
aaggtagacctttccacagattgctag

KEGG   Homo sapiens (human): 3695Help
Entry
3695              CDS       T01001                                 

Gene name
ITGB7
Definition
(RefSeq) integrin subunit beta 7
  KO
K06590  integrin beta 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04514  Cell adhesion molecules (CAMs)
hsa04672  Intestinal immune network for IgA production
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05202  Transcriptional misregulation in cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06135  Cytoskeletal regulation (viruses)
nt06167  Human cytomegalovirus (HCMV)
nt06240  Transcription
  Element
N00124  IGH-MAF fusion to transcriptional activation
N00393  ITGA/B-RhoA signaling pathway
Drug target
Abrilumab: D10540
Etrolizumab: D09901
Valategrast hydrochloride: D10028
Vedolizumab: D08083
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3695 (ITGB7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3695 (ITGB7)
   04514 Cell adhesion molecules (CAMs)
    3695 (ITGB7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3695 (ITGB7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3695 (ITGB7)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    3695 (ITGB7)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    3695 (ITGB7)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    3695 (ITGB7)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3695 (ITGB7)
   05414 Dilated cardiomyopathy (DCM)
    3695 (ITGB7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3695 (ITGB7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3695 (ITGB7)
   04515 Cell adhesion molecules [BR:hsa04515]
    3695 (ITGB7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3695 (ITGB7)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin beta subunits
   3695 (ITGB7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt PSI_integrin I-EGF_1 EGF_2
Motif
Other DBs
NCBI-GeneID: 3695
NCBI-ProteinID: NP_000880
OMIM: 147559
HGNC: 6162
Ensembl: ENSG00000139626
Vega: OTTHUMG00000169775
Pharos: P26010(Tclin)
UniProt: P26010
Structure
PDB: 

Position
12q13.13
AA seq 798 aa AA seqDB search
MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG
KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
TQPQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGK
GHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DMDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFRTG
PLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKG
ADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQDSNPLYKS
AITTTINPRFQEADSPTL
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggtggctttgccaatggtccttgttttgctgctggtcctgagcagaggtgagagtgaa
ttggacgccaagatcccatccacaggggatgccacagaatggcggaatcctcacctgtcc
atgctggggtcctgccagccagccccctcctgccagaagtgcatcctctcacaccccagc
tgtgcatggtgcaagcaactgaacttcaccgcgtcgggagaggcggaggcgcggcgctgc
gcccgacgagaggagctgctggctcgaggctgcccgctggaggagctggaggagccccgc
ggccagcaggaggtgctgcaggaccagccgctcagccagggcgcccgcggagagggtgcc
acccagctggcgccgcagcgggtccgggtcacgctgcggcctggggagccccagcagctc
caggtccgcttccttcgtgctgagggatacccggtggacctgtactaccttatggacctg
agctactccatgaaggacgacctggaacgcgtgcgccagctcgggcacgctctgctggtc
cggctgcaggaagtcacccattctgtgcgcattggttttggttcctttgtggacaaaacg
gtgctgccctttgtgagcacagtaccctccaaactgcgccacccctgccccacccggctg
gagcgctgccagtcaccattcagctttcaccatgtgctgtccctgacgggggacgcacaa
gccttcgagcgggaggtggggcgccagagtgtgtccggcaatctggactcgcctgaaggt
ggcttcgatgccattctgcaggctgcactctgccaggagcagattggctggagaaatgtg
tcccggctgctggtgttcacttcagacgacacattccatacagctggggacgggaagttg
ggcggcattttcatgcccagtgatgggcactgccacttggacagcaatggcctctacagt
cgcagcacagagtttgactacccttctgtgggtcaggtagcccaggccctctctgcagca
aatatccagcccatctttgctgtcaccagtgccgcactgcctgtctaccaggagctgagt
aaactgattcctaagtctgcagttggggagctgagtgaggactccagcaacgtggtacag
ctcatcatggatgcttataatagcctgtcttccaccgtgacccttgaacactcttcactc
cctcctggggtccacatttcttacgaatcccagtgtgagggtcctgagaagagggagggt
aaggctgaggatcgaggacagtgcaaccacgtccgaatcaaccagacggtgactttctgg
gtttctctccaagccacccactgcctcccagagccccatctcctgaggctccgggccctt
ggcttctcagaggagctgattgtggagttgcacacgctgtgtgactgtaattgcagtgac
acccagccccaggctccccactgcagtgatggccagggacacctacaatgtggtgtatgc
agctgtgcccctggccgcctaggtcggctctgtgagtgctctgtggcagagctgtcctcc
ccagacctggaatctgggtgccgggctcccaatggcacagggcccctgtgcagtggaaag
ggtcactgtcaatgtggacgctgcagctgcagtggacagagctctgggcatctgtgcgag
tgtgacgatgccagctgtgagcgacatgagggcatcctctgcggaggctttggtcgctgc
caatgtggagtatgtcactgtcatgccaaccgcacgggcagagcatgcgaatgcagtggg
gacatggacagttgcatcagtcccgagggagggctctgcagtgggcatggacgctgcaaa
tgcaaccgctgccagtgcttggacggctactatggtgctctatgcgaccaatgcccaggc
tgcaagacaccatgcgagagacaccgggactgtgcagagtgtggggccttcaggactggc
ccactggccaccaactgcagtacagcttgtgcccataccaatgtgaccctggccttggcc
cctatcttggatgatggctggtgcaaagagcggaccctggacaaccagctgttcttcttc
ttggtggaggatgacgccagaggcacggtcgtgctcagagtgagaccccaagaaaaggga
gcagaccacacgcaggccattgtgctgggctgcgtagggggcatcgtggcagtggggctg
gggctggtcctggcttaccggctctcggtggaaatctatgaccgccgggaatacagtcgc
tttgagaaggagcagcaacaactcaactggaagcaggacagtaatcctctctacaaaagt
gccatcacgaccaccatcaatcctcgctttcaagaggcagacagtcccactctctga

KEGG   Homo sapiens (human): 3696Help
Entry
3696              CDS       T01001                                 

Gene name
ITGB8
Definition
(RefSeq) integrin subunit beta 8
  KO
K06591  integrin beta 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04514  Cell adhesion molecules (CAMs)
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06135  Cytoskeletal regulation (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3696 (ITGB8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3696 (ITGB8)
   04514 Cell adhesion molecules (CAMs)
    3696 (ITGB8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3696 (ITGB8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3696 (ITGB8)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    3696 (ITGB8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3696 (ITGB8)
   05414 Dilated cardiomyopathy (DCM)
    3696 (ITGB8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3696 (ITGB8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3696 (ITGB8)
   04515 Cell adhesion molecules [BR:hsa04515]
    3696 (ITGB8)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3696 (ITGB8)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin beta subunits
   3696 (ITGB8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta PSI_integrin EGF_2 Sigma_reg_N
Motif
Other DBs
NCBI-GeneID: 3696
NCBI-ProteinID: NP_002205
OMIM: 604160
HGNC: 6163
Ensembl: ENSG00000105855
Vega: OTTHUMG00000023594
Pharos: P26012(Tbio)
UniProt: P26012 Q9BUG9
Structure
PDB: 

Position
7p21.1
AA seq 769 aa AA seqDB search
MCGSALAFFTAAFVCLQNDRRGPASFLWAAWVFSLVLGLGQGEDNRCASSNAASCARCLA
LGPECGWCVQEDFISGGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTP
GEVSIQLRPGAEANFMLKVHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFF
SRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKA
VHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIV
VPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPG
TIAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVQGIYFNITAICPDGSRKPGMEGCR
NVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGK
CVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGK
VYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQV
CSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTS
CALMEQQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSS
DYRVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggctcggccctggctttttttaccgctgcatttgtctgcctgcaaaacgaccgg
cgaggtcccgcctcgttcctctgggcagcctgggtgttttcacttgttcttggactgggc
caaggtgaagacaatagatgtgcatcttcaaatgcagcatcctgtgccaggtgccttgcg
ctgggtccagaatgtggatggtgtgttcaagaggatttcatttcaggtggatcaagaagt
gaacgttgtgatattgtttccaatttaataagcaaaggctgctcagttgattcaatagaa
tacccatctgtgcatgttataatacccactgaaaatgaaattaatacccaggtgacacca
ggagaagtgtctatccagctgcgtccaggagccgaagctaattttatgctgaaagttcat
cctctgaagaaatatcctgtggatctttattatcttgttgatgtctcagcatcaatgcac
aataatatagaaaaattaaattccgttggaaacgatttatctagaaaaatggcatttttc
tcccgtgactttcgtcttggatttggctcatacgttgataaaacagtttcaccatacatt
agcatccaccccgaaaggattcataatcaatgcagtgactacaatttagactgcatgcct
ccccatggatacatccatgtgctgtctttgacagagaacatcactgagtttgagaaagca
gttcatagacagaagatctctggaaacatagatacaccagaaggaggttttgacgccatg
cttcaggcagctgtctgtgaaagtcatatcggatggcgaaaagaggctaaaagattgctg
ctggtgatgacagatcagacgtctcatctcgctcttgatagcaaattggcaggcatagtg
gtgcccaatgacggaaactgtcatctgaaaaacaacgtctatgtcaaatcgacaaccatg
gaacacccctcactaggccaactttcagagaaattaatagacaacaacattaatgtcatc
tttgcagttcaaggaaaacaatttcattggtataaggatcttctacccctcttgccaggc
accattgctggtgaaatagaatcaaaggctgcaaacctcaataatttggtagtggaagcc
tatcagaagctcatttcagaagtgaaagttcaggtggaaaaccaggtacaaggcatctat
tttaacattaccgccatctgtccagatgggtccagaaagccaggcatggaaggatgcaga
aacgtgacgagcaatgatgaagttcttttcaatgtaacagttacaatgaaaaaatgtgat
gtcacaggaggaaaaaactatgcaataatcaaacctattggttttaatgaaaccgctaaa
attcatatacacagaaactgcagctgtcagtgtgaggacaacagaggacctaaaggaaag
tgtgtagatgaaacttttctagattccaagtgtttccagtgtgatgagaataaatgtcat
tttgatgaagatcagttttcttctgagagttgcaagtcacacaaggatcagcctgtttgc
agtggtcgaggagtttgtgtttgtgggaaatgttcatgtcacaaaattaagcttggaaaa
gtgtatggaaaatactgtgaaaaggatgacttttcttgtccatatcaccatggaaatctg
tgtgctgggcatggagagtgtgaagcaggcagatgccaatgcttcagtggctgggaaggt
gatcgatgccagtgcccttcagcagcagcccagcactgtgtcaattcaaagggccaagtg
tgcagtggaagaggcacgtgtgtgtgtggaaggtgtgagtgcaccgatcccaggagcatc
ggccgcttctgtgaacactgccccacctgttatacagcctgcaaggaaaactggaattgt
atgcaatgccttcaccctcacaatttgtctcaggctatacttgatcagtgcaaaacctca
tgtgctctcatggaacaacagcattatgtcgaccaaacttcagaatgtttctccagccca
agctacttgagaatatttttcatcattttcatagttacattcttgattgggttgcttaaa
gtcctgatcattagacaggtgatactacaatggaatagtaataaaattaagtcctcatca
gattacagagtgtcagcctcaaaaaaggataagttgattctgcaaagtgtttgcacaaga
gcagtcacctaccgacgtgagaagcctgaagaaataaaaatggatatcagcaaattaaat
gctcatgaaactttcaggtgcaacttctaa

DBGET integrated database retrieval system