KEGG   Homo sapiens (human): 3694Help
Entry
3694              CDS       T01001                                 

Gene name
ITGB6, AI1H
Definition
(RefSeq) integrin subunit beta 6
  KO
K06589  integrin beta 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06135  Cytoskeletal regulation (virus)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoA signaling pathway
Disease
H00615  Amelogenesis imperfecta
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3694 (ITGB6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3694 (ITGB6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3694 (ITGB6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3694 (ITGB6)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    3694 (ITGB6)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3694 (ITGB6)
   05414 Dilated cardiomyopathy (DCM)
    3694 (ITGB6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3694 (ITGB6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3694 (ITGB6)
   04515 Cell adhesion molecules [BR:hsa04515]
    3694 (ITGB6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3694 (ITGB6)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin beta subunits
   3694 (ITGB6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Motif
Other DBs
NCBI-GeneID: 3694
NCBI-ProteinID: NP_000879
OMIM: 147558
HGNC: 6161
Ensembl: ENSG00000115221
Vega: OTTHUMG00000132026
Pharos: P18564(Tbio)
UniProt: P18564
Structure
PDB: 

Position
2q24.2
AA seq 788 aa AA seqDB search
MGIELLCLFFLFLGRNDHVQGGCALGGAETCEDCLLIGPQCAWCAQENFTHPSGVGERCD
TPANLLAKGCQLNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQT
LQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEK
PVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFSVT
VNIPHCERRSRHIIIKPVGLGDALELLVSPECNCDCQKEVEVNSSKCHHGNGSFQCGVCA
CHPGHMGPRCECGEDMLSTDSCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCD
NFSCVRHKGLLCGGNGDCDCGECVCRSGWTGEYCNCTTSTDSCVSEDGVLCSGRGDCVCG
KCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEE
DFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSINEKDCPKPPNIPMIMLGVSLAIL
LIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQ
KVDLSTDC
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggggattgaactgctttgcctgttctttctatttctaggaaggaatgatcacgtacaa
ggtggctgtgccctgggaggtgcagaaacctgtgaagactgcctgcttattggacctcag
tgtgcctggtgtgctcaggagaattttactcatccatctggagttggcgaaaggtgtgat
accccagcaaaccttttagctaaaggatgtcaattaaacttcatcgaaaaccctgtctcc
caagtagaaatacttaaaaataagcctctcagtgtaggcagacagaaaaatagttctgac
attgttcagattgcgcctcaaagcttgatccttaagttgagaccaggtggtgcgcagact
ctgcaggtgcatgtccgccagactgaggactacccggtggatttgtattacctcatggac
ctctccgcctccatggatgacgacctcaacacaataaaggagctgggctcccggctttcc
aaagagatgtctaaattaaccagcaactttagactgggcttcggatcttttgtggaaaaa
cctgtatccccttttgtgaaaacaacaccagaagaaattgccaacccttgcagtagtatt
ccatacttctgtttacctacatttggattcaagcacattttgccattgacaaatgatgct
gaaagattcaatgaaattgtgaagaatcagaaaatttctgctaatattgacacacccgaa
ggtggatttgatgcaattatgcaagctgctgtgtgtaaggaaaaaattggctggcggaat
gactccctccacctcctggtctttgtgagtgatgctgattctcattttggaatggacagc
aaactagcaggcatcgtcattcctaatgacgggctctgtcacttggacagcaagaatgaa
tactccatgtcaactgtcttggaatatccaacaattggacaactcattgataaactggta
caaaacaacgtgttattgatcttcgctgtaacccaagaacaagttcatttatatgagaat
tacgcaaaacttattcctggagctacagtaggtctacttcagaaggactccggaaacatt
ctccagctgatcatctcagcttatgaagaactgcggtctgaggtggaactggaagtatta
ggagacactgaaggactcaacttgtcatttacagccatctgtaacaacggtaccctcttc
caacaccaaaagaaatgctctcacatgaaagtgggagacacagcttccttcagcgtgact
gtgaatatcccacactgcgagagaagaagcaggcacattatcataaagcctgtggggctg
ggggatgccctggaattacttgtcagcccagaatgcaactgcgactgtcagaaagaagtg
gaagtgaacagctccaaatgtcaccacgggaacggctctttccagtgtggggtgtgtgcc
tgccaccctggccacatggggcctcgctgtgagtgtggcgaggacatgctgagcacagat
tcctgcaaggaggccccagatcatccctcctgcagcggaaggggtgactgctactgtggg
cagtgtatctgccacttgtctccctatggaaacatttatgggccttattgccagtgtgac
aatttctcctgcgtgagacacaaagggctgctctgcggaggtaacggcgactgtgactgt
ggtgaatgtgtgtgcaggagcggctggactggcgagtactgcaactgcaccaccagcacg
gactcctgcgtctctgaagatggagtgctctgcagcgggcgcggggactgtgtttgtggc
aagtgtgtttgcacaaaccctggagcctcaggaccaacctgtgaacgatgtcctacctgt
ggtgacccctgtaactctaaacggagctgcattgagtgccacctgtcagcagctggccaa
gcccgagaagaatgtgtggacaagtgcaaactagctggtgcgaccatcagtgaagaagaa
gatttctcaaaggatggttctgtttcctgctctctgcaaggagaaaatgaatgtcttatt
acattcctaataactacagataatgaggggaaaaccatcattcacagcatcaatgaaaaa
gattgtccgaagcctccaaacattcccatgatcatgttaggggtttccctggctattctt
ctcatcggggttgtcctactgtgcatctggaagctactggtgtcatttcatgatcgtaaa
gaagttgccaaatttgaagcagaacgatcaaaagccaagtggcaaacgggaaccaatcca
ctctacagaggatccacaagtacttttaaaaatgtaacttataaacacagggaaaaacaa
aaggtagacctttccacagattgctag

DBGET integrated database retrieval system