KEGG   Homo sapiens (human): 3695Help
Entry
3695              CDS       T01001                                 

Gene name
ITGB7
Definition
(RefSeq) integrin subunit beta 7
  KO
K06590  integrin beta 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04514  Cell adhesion molecules (CAMs)
hsa04672  Intestinal immune network for IgA production
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05202  Transcriptional misregulation in cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Network
N00124  IGH-MAF fusion to transcriptional activation
N00393  ITGA/B-RhoA signaling pathway
Drug target
Abrilumab: D10540
Etrolizumab: D09901
Valategrast hydrochloride: D10028
Vedolizumab: D08083
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3695 (ITGB7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3695 (ITGB7)
   04514 Cell adhesion molecules (CAMs)
    3695 (ITGB7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3695 (ITGB7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3695 (ITGB7)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    3695 (ITGB7)
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    3695 (ITGB7)
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    3695 (ITGB7)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3695 (ITGB7)
   05414 Dilated cardiomyopathy (DCM)
    3695 (ITGB7)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    3695 (ITGB7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3695 (ITGB7)
   04515 Cell adhesion molecules [BR:hsa04515]
    3695 (ITGB7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3695 (ITGB7)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin beta subunits
   3695 (ITGB7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt PSI_integrin EGF_2
Motif
Other DBs
NCBI-GeneID: 3695
NCBI-ProteinID: NP_000880
OMIM: 147559
HGNC: 6162
Ensembl: ENSG00000139626
Vega: OTTHUMG00000169775
Pharos: P26010(Tclin)
UniProt: P26010
Structure
PDB: 

Position
12q13.13
AA seq 798 aa AA seqDB search
MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG
KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
TQPQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGK
GHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DMDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFRTG
PLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKG
ADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQDSNPLYKS
AITTTINPRFQEADSPTL
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggtggctttgccaatggtccttgttttgctgctggtcctgagcagaggtgagagtgaa
ttggacgccaagatcccatccacaggggatgccacagaatggcggaatcctcacctgtcc
atgctggggtcctgccagccagccccctcctgccagaagtgcatcctctcacaccccagc
tgtgcatggtgcaagcaactgaacttcaccgcgtcgggagaggcggaggcgcggcgctgc
gcccgacgagaggagctgctggctcgaggctgcccgctggaggagctggaggagccccgc
ggccagcaggaggtgctgcaggaccagccgctcagccagggcgcccgcggagagggtgcc
acccagctggcgccgcagcgggtccgggtcacgctgcggcctggggagccccagcagctc
caggtccgcttccttcgtgctgagggatacccggtggacctgtactaccttatggacctg
agctactccatgaaggacgacctggaacgcgtgcgccagctcgggcacgctctgctggtc
cggctgcaggaagtcacccattctgtgcgcattggttttggttcctttgtggacaaaacg
gtgctgccctttgtgagcacagtaccctccaaactgcgccacccctgccccacccggctg
gagcgctgccagtcaccattcagctttcaccatgtgctgtccctgacgggggacgcacaa
gccttcgagcgggaggtggggcgccagagtgtgtccggcaatctggactcgcctgaaggt
ggcttcgatgccattctgcaggctgcactctgccaggagcagattggctggagaaatgtg
tcccggctgctggtgttcacttcagacgacacattccatacagctggggacgggaagttg
ggcggcattttcatgcccagtgatgggcactgccacttggacagcaatggcctctacagt
cgcagcacagagtttgactacccttctgtgggtcaggtagcccaggccctctctgcagca
aatatccagcccatctttgctgtcaccagtgccgcactgcctgtctaccaggagctgagt
aaactgattcctaagtctgcagttggggagctgagtgaggactccagcaacgtggtacag
ctcatcatggatgcttataatagcctgtcttccaccgtgacccttgaacactcttcactc
cctcctggggtccacatttcttacgaatcccagtgtgagggtcctgagaagagggagggt
aaggctgaggatcgaggacagtgcaaccacgtccgaatcaaccagacggtgactttctgg
gtttctctccaagccacccactgcctcccagagccccatctcctgaggctccgggccctt
ggcttctcagaggagctgattgtggagttgcacacgctgtgtgactgtaattgcagtgac
acccagccccaggctccccactgcagtgatggccagggacacctacaatgtggtgtatgc
agctgtgcccctggccgcctaggtcggctctgtgagtgctctgtggcagagctgtcctcc
ccagacctggaatctgggtgccgggctcccaatggcacagggcccctgtgcagtggaaag
ggtcactgtcaatgtggacgctgcagctgcagtggacagagctctgggcatctgtgcgag
tgtgacgatgccagctgtgagcgacatgagggcatcctctgcggaggctttggtcgctgc
caatgtggagtatgtcactgtcatgccaaccgcacgggcagagcatgcgaatgcagtggg
gacatggacagttgcatcagtcccgagggagggctctgcagtgggcatggacgctgcaaa
tgcaaccgctgccagtgcttggacggctactatggtgctctatgcgaccaatgcccaggc
tgcaagacaccatgcgagagacaccgggactgtgcagagtgtggggccttcaggactggc
ccactggccaccaactgcagtacagcttgtgcccataccaatgtgaccctggccttggcc
cctatcttggatgatggctggtgcaaagagcggaccctggacaaccagctgttcttcttc
ttggtggaggatgacgccagaggcacggtcgtgctcagagtgagaccccaagaaaaggga
gcagaccacacgcaggccattgtgctgggctgcgtagggggcatcgtggcagtggggctg
gggctggtcctggcttaccggctctcggtggaaatctatgaccgccgggaatacagtcgc
tttgagaaggagcagcaacaactcaactggaagcaggacagtaatcctctctacaaaagt
gccatcacgaccaccatcaatcctcgctttcaagaggcagacagtcccactctctga

DBGET integrated database retrieval system