KEGG   Homo sapiens (human): 3698
Entry
3698              CDS       T01001                                 

Gene name
ITIH2, H2P, SHAP
Definition
(RefSeq) inter-alpha-trypsin inhibitor heavy chain 2
  KO
K19015  inter-alpha-trypsin inhibitor heavy chain H2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3698 (ITIH2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   3698 (ITIH2)
SSDB
Motif
Pfam: ITI_HC_C VIT VWA VWA_3 VWA_2 VWA_CoxE SPACA9 Peptidase_M60 DUF2201
Other DBs
NCBI-GeneID: 3698
NCBI-ProteinID: NP_002207
OMIM: 146640
HGNC: 6167
Ensembl: ENSG00000151655
Vega: OTTHUMG00000017633
Pharos: P19823(Tbio)
UniProt: P19823
Position
10p14
AA seq 946 aa
MKRLTCFFICFFLSEVSGFEIPINGLSEFVDYEDLVELAPGKFQLVAENRRYQRSLPGES
EEMMEEVDQVTLYSYKVQSTITSRMATTMIQSKVVNNSPQPQNVVFDVQIPKGAFISNFS
MTVDGKTFRSSIKEKTVGRALYAQARAKGKTAGLVRSSALDMENFRTEVNVLPGAKVQFE
LHYQEVKWRKLGSYEHRIYLQPGRLAKHLEVDVWVIEPQGLRFLHVPDTFEGHFDGVPVI
SKGQQKAHVSFKPTVAQQRICPNCRETAVDGELVVLYDVKREEKAGELEVFNGYFVHFFA
PDNLDPIPKNILFVIDVSGSMWGVKMKQTVEAMKTILDDLRAEDHFSVIDFNQNIRTWRN
DLISATKTQVADAKRYIEKIQPSGGTNINEALLRAIFILNEANNLGLLDPNSVSLIILVS
DGDPTVGELKLSKIQKNVKENIQDNISLFSLGMGFDVDYDFLKRLSNENHGIAQRIYGNQ
DTSSQLKKFYNQVSTPLLRNVQFNYPHTSVTDVTQNNFHNYFGGSEIVVAGKFDPAKLDQ
IESVITATSANTQLVLETLAQMDDLQDFLSKDKHADPDFTRKLWAYLTINQLLAERSLAP
TAAAKRRITRSILQMSLDHHIVTPLTSLVIENEAGDERMLADAPPQDPSCCSGALYYGSK
VVPDSTPSWANPSPTPVISMLAQGSQVLESTPPPHVMRVENDPHFIIYLPKSQKNICFNI
DSEPGKILNLVSDPESGIVVNGQLVGAKKPNNGKLSTYFGKLGFYFQSEDIKIEISTETI
TLSHGSSTFSLSWSDTAQVTNQRVQISVKKEKVVTITLDKEMSFSVLLHRVWKKHPVNVD
FLGIYIPPTNKFSPKAHGLIGQFMQEPKIHIFNERPGKDPEKPEASMEVKGQKLIITRGL
QKDYRTDLVFGTDVTCWFVHNSGKGFIDGHYKDYFVPQLYSFLKRP
NT seq 2841 nt   +upstreamnt  +downstreamnt
atgaaaagactcacgtgctttttcatctgcttctttctttctgaagtatcaggcttcgaa
atccccataaatggactttctgaatttgtagactatgaagatcttgtggaactggcccca
ggcaaatttcaattggtggcagagaaccggagatatcagagaagccttccaggagaatcg
gaagaaatgatggaagaggttgatcaagtaactctttatagctataaagtccagtctact
attacttctcggatggccaccaccatgatccagagcaaagtggtgaacaattccccgcag
cctcagaatgtcgtgtttgatgttcagatccccaaaggagcattcatttccaacttctcc
atgactgtggacggcaagacatttaggagctctattaaggagaaaactgtgggccgagct
ctttatgcacaggccagagcaaaaggcaagacggctggcttggtgaggagcagcgctctt
gatatggaaaacttcagaacggaagtaaatgtcctcccaggagcaaaggtgcagttcgaa
cttcactaccaggaggtgaagtggaggaagctgggctcctatgagcacaggatctatctg
caacctggacggctggccaaacacttagaggtagatgtgtgggttatcgaaccacaggga
ctgagatttcttcatgttcccgacacatttgaaggccatttcgatggtgttccggtcatt
tctaaaggacaacagaaggcgcacgtctccttcaagcccacggtagcacagcagagaata
tgccctaactgccgggagactgcggtagatggggaactggtggtgctgtatgacgtgaaa
agagaagagaaggctggtgaactggaggtgtttaatggatattttgtccacttctttgct
cctgacaacctggacccaattcccaaaaacatcctctttgtcatcgatgtgagtggctcc
atgtggggagttaaaatgaaacaaactgtggaagcaatgaagaccatattggatgacctc
agagcagaagaccatttctctgtgattgatttcaaccagaacattcgaacttggagaaat
gatttaatttcagctacaaaaacacaggttgcagatgccaagaggtatattgagaaaatc
cagcccagtggaggcacaaacatcaacgaagcactcctacgggcaatcttcattttgaat
gaagccaataacttgggactgttagaccccaactccgtctcgctgatcattttggtttct
gatggagatccaacagtgggcgaactaaaactgtcaaaaattcagaaaaacgttaaggag
aacatccaagacaatatctccttgttcagtttgggcatgggatttgatgtggactatgat
tttttgaagagactgtccaatgaaaaccatggaattgcacaaaggatttatggaaaccag
gacacgtcttcccagcttaagaaattctacaaccaggtctccactccattgctccggaat
gttcagttcaactatccccatacatcagtcacggacgtcactcaaaacaatttccataac
tactttggaggctcagagattgtggtggcaggaaaatttgaccctgctaaattggatcaa
atagagagcgttatcacggcgacttcggctaacacgcagttagtcttggagaccctggcc
cagatggacgacttgcaggattttctatcgaaagacaagcatgcagatcccgatttcacc
aggaaactgtgggcctatctaaccatcaaccaactgctagctgaacgaagcctggctcct
acagctgccgccaagagaagaattacaagatcgatcctgcagatgtctctagaccaccac
attgtgactccgctgacctcgctggtgatcgagaacgaggctggggatgagcgcatgctg
gcggatgccccaccgcaggatccctcctgctgctcaggggccctgtattacggcagcaaa
gtggttccagattccaccccgtcttgggccaatccttcaccaacgcccgtgatctccatg
ctggcacaaggatctcaggtgctagagtccacgccacccccacatgtgatgagagttgaa
aatgacccacatttcatcatttatctaccaaaaagccaaaagaacatttgtttcaatatt
gactcagaacctggaaaaatcctcaacctggtttctgacccagaatcaggaattgtagtc
aacggtcagcttgttggtgccaagaagcccaacaatggaaaactaagcacctattttgga
aaactgggattttatttccaaagtgaagacataaaaatagaaatcagcactgagaccatc
accctgagccatggttctagcacattctccttgtcctggtccgacacggctcaagtcacg
aatcagagggtgcagatctcagtgaagaaagaaaaagtggtaactatcaccctggataaa
gagatgtccttttctgttttacttcatcgtgtttggaagaagcatcccgtcaatgttgac
tttctgggaatctacataccccctacaaacaagttctcacctaaagcccacggactaata
ggccagttcatgcaggaaccaaagatacacatcttcaatgagagaccaggaaaggaccct
gagaagccagaggccagcatggaagtgaaggggcagaagctgatcatcaccaggggctta
cagaaagactacagaacggatctagtgtttggaacggacgttacctgctggtttgtgcac
aacagtggaaaaggattcattgacgggcattacaaggattacttcgtgcctcagctctac
agctttctcaaacggccttaa

DBGET integrated database retrieval system