KEGG   Homo sapiens (human): 3699Help
Entry
3699              CDS       T01001                                 

Gene name
ITIH3, H3P, ITI-HC3, SHAP
Definition
(RefSeq) inter-alpha-trypsin inhibitor heavy chain 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: ITI_HC_C VIT VWA VWA_3 VWA_2 vWA-TerF-like Glyco_hydro_61 VWA_CoxE DUF2201
Motif
Other DBs
NCBI-GeneID: 3699
NCBI-ProteinID: NP_002208
OMIM: 146650
HGNC: 6168
Ensembl: ENSG00000162267
Vega: OTTHUMG00000158956
Pharos: Q06033(Tbio)
UniProt: Q06033
Position
3p21.1
AA seq 890 aa AA seqDB search
MAFAWWPCLILALLSSLAASGFPRSPFRLLGKRSLPEGVANGIEVYSTKINSKVTSRFAH
NVVTMRAVNRADTAKEVSFDVELPKTAFITNFTLTIDGVTYPGNVKEKEVAKKQYEKAVS
QGKTAGLVKASGRKLEKFTVSVNVAAGSKVTFELTYEELLKRHKGKYEMYLKVQPKQLVK
HFEIEVDIFEPQGISMLDAEASFITNDLLGSALTKSFSGKKGHVSFKPSLDQQRSCPTCT
DSLLNGDFTITYDVNRESPGNVQIVNGYFVHFFAPQGLPVVPKNVAFVIDISGSMAGRKL
EQTKEALLRILEDMQEEDYLNFILFSGDVSTWKEHLVQATPENLQEARTFVKSMEDKGMT
NINDGLLRGISMLNKAREEHRIPERSTSIVIMLTDGDANVGESRPEKIQENVRNAIGGKF
PLYNLGFGNNLNYNFLENMALENHGFARRIYEDSDADLQLQGFYEEVANPLLTGVEMEYP
ENAILDLTQNTYQHFYDGSEIVVAGRLVDEDMNSFKADVKGHGATNDLTFTEEVDMKEME
KALQERDYIFGNYIERLWAYLTIEQLLEKRKNAHGEEKENLTARALDLSLKYHFVTPLTS
MVVTKPEDNEDERAIADKPGEDAEATPVSPAMSYLTSYQPPQNPYYYVDGDPHFIIQIPE
KDDALCFNIDEAPGTVLRLIQDAVTGLTVNGQITGDKRGSPDSKTRKTYFGKLGIANAQM
DFQVEVTTEKITLWNRAVPSTFSWLDTVTVTQDGLSMMINRKNMVVSFGDGVTFVVVLHQ
VWKKHPVHRDFLGFYVVDSHRMSAQTHGLLGQFFQPFDFKVSDIRPGSDPTKPDATLVVK
NHQLIVTRGSQKDYRKDASIGTKVVCWFVHNNGEGLIDGVHTDYIVPNLF
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgcatggtggccctgtctcatcttggctctgctctccagcttggcagcctct
ggcttcccgagaagcccctttcggctgcttgggaaacggagcctcccggaaggggtggcc
aatggcatcgaggtctacagtaccaaaatcaactccaaggtgacctcccgttttgctcac
aatgttgtcaccatgagagccgtcaaccgtgcagacacggccaaggaggtttcctttgat
gtggagctgcccaagacggccttcatcaccaacttcaccttgaccatcgacggtgttacc
taccctgggaatgtcaaggagaaggaagttgccaagaagcagtatgaaaaggctgtgtcc
cagggcaagacggccggcttggtcaaggcctctgggaggaagttggagaagttcacagtc
tcggtcaacgtggctgcaggcagcaaagtcaccttcgagctaacctacgaggagctgctg
aagaggcacaagggcaagtacgagatgtacctcaaggtccagcctaagcaactggtcaaa
cactttgagatcgaggtagacatcttcgagcctcagggaatcagcatgctggatgctgag
gcctctttcatcaccaacgacctcctgggaagcgccctcaccaagtccttctcagggaaa
aagggccatgtgtccttcaagcccagcttagaccaacagcgttcatgcccaacctgtaca
gactccctcctcaatggagatttcactatcacctatgacgtgaacagagaatctcctggc
aacgtgcagatagtcaatggctacttcgtgcacttctttgcacctcaaggccttccagtg
gtgcctaagaacgtggcctttgtgattgacatcagcggctccatggctggtcggaaatta
gagcagacaaaggaggcccttctcagaatcctggaagatatgcaagaggaagactatctg
aatttcatcctgttcagtggagatgtgtccacatggaaagagcacttagtccaggccacg
cccgagaacctccaggaggccaggacgtttgtgaagagcatggaggataaaggaatgacc
aacatcaatgacgggctgctgaggggcatcagtatgctgaacaaggcccgagaggagcac
agaatcccagagaggagcacctccattgtcatcatgctgactgatggggatgccaatgtt
ggtgagagcagacccgaaaaaatccaagagaatgtgcggaatgccatcgggggcaagttc
cccttgtataacctgggctttggcaacaatctgaattataacttcctggagaacatggcc
ctggagaaccatgggtttgcccggcgcatttatgaggactctgatgccgatttgcagttg
cagggcttctatgaggaggtggccaacccactgctgacgggtgtggagatggagtacccc
gagaacgctatcctggacctcacccagaacacttaccagcacttctacgatggctctgag
atcgtggtggccgggcgcctggtggacgaggacatgaacagctttaaggcagatgtgaag
ggccatggggccaccaacgacctgaccttcacagaggaggtggacatgaaggagatggag
aaggccctgcaggagcgggactacatcttcgggaattacattgagcggctctgggcctac
ctcaccattgagcagctgctggagaagcgcaagaacgcccatggcgaggagaaggagaac
ctcacggcccgggccctggacctgtccctcaagtatcactttgtgactccactgacctca
atggtggtgaccaagcctgaggacaacgaggatgagagggccattgccgacaagcctggg
gaagatgcagaagccacaccggtgagccccgccatgtcctacctgaccagctaccagcct
cctcaaaacccctactactatgtggacggggatccccacttcatcatccaaattccggag
aaagacgatgccctctgcttcaacatcgatgaagccccaggcacagtgctgcgccttatt
caggatgcagtcacaggcctcacagttaatgggcagatcactggcgacaagagaggcagc
cctgactccaagaccagaaagacttactttggaaaactgggcatcgccaatgctcagatg
gacttccaggtggaggtgacaacggagaagatcaccctgtggaacagggccgtgccgagc
actttcagctggctggacacagtcacagtcacgcaggatgggctgtccatgatgatcaac
aggaagaacatggtggtctcctttggagatggggttaccttcgtggtcgtcctacaccag
gtgtggaagaaacatcctgtccaccgtgactttctaggcttctacgtggtggacagtcac
cggatgtcagcacagacgcatgggctgctggggcaattcttccaaccctttgactttaaa
gtgtctgacatccggccaggctctgaccccacaaagccagatgccacattggtggtgaag
aaccatcagctgattgtcaccaggggctcccagaaagactacagaaaggatgccagcatc
ggcacgaaggttgtctgctggttcgtccacaacaacggagaagggctgattgatggtgtc
cacactgactacattgtccccaacctgttttga

DBGET integrated database retrieval system