KEGG   Homo sapiens (human): 3703
Entry
3703              CDS       T01001                                 

Gene name
STT3A, ITM1, STT3-A, TMC
Definition
(RefSeq) STT3 oligosaccharyltransferase complex catalytic subunit A
  KO
K07151  dolichyl-diphosphooligosaccharide---protein glycosyltransferase [EC:2.4.99.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa00513  Various types of N-glycan biosynthesis
hsa01100  Metabolic pathways
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00072  N-glycosylation by oligosaccharyltransferase
Network
nt06015  N-Glycan biosynthesis
  Element
N00654  STT3A deficiency in N-glycan precursor biosynthesis
N00681  N-Glycan precursor biosynthesis, ALG6 to OST
Disease
H00118  Congenital disorders of glycosylation type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    3703 (STT3A)
   00513 Various types of N-glycan biosynthesis
    3703 (STT3A)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3703 (STT3A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    3703 (STT3A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.18  dolichyl-diphosphooligosaccharide---protein glycotransferase
     3703 (STT3A)
Glycosyltransferases [BR:hsa01003]
 N-Glycan biosynthesis
  N-linked oligosaccharide
   3703 (STT3A)
SSDB
Motif
Pfam: STT3 PMT_2 DUF2985
Other DBs
NCBI-GeneID: 3703
NCBI-ProteinID: NP_001265432
OMIM: 601134
HGNC: 6172
Ensembl: ENSG00000134910
Vega: OTTHUMG00000165852
Pharos: P46977(Tbio)
UniProt: P46977
Position
11q24.2
AA seq 705 aa
MTKFGFLRLSYEKQDTLLKLLILSMAAVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFL
AEEGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLA
PLFSSFTTIVTYHLTKELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTY
YMWIKAVKTGSICWAAKCALAYFYMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAY
CTVYCLGTILSMQISFVGFQPVLSSEHMAAFGVFGLCQIHAFVDYLRSKLNPQQFEVLFR
SVISLVGFVLLTVGALLMLTGKISPWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSY
YFDLQLLVFMFPVGLYYCFSNLSDARIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGI
GVSQVLSTYMKNLDISRPDKKSKKQQDSTYPIKNEVASGMILVMAFFLITYTFHSTWVTS
EAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTI
LVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMV
RIGGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGF
DRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRGLSRT
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgactaagtttggatttttgcgattgtcctatgagaagcaggacacacttttgaagctt
ctcattctgtcaatggctgctgtattatccttctccactcgtctgtttgctgtcctgaga
tttgaaagtgttatccatgagtttgatccgtactttaattatcggactaccaggttcctg
gctgaggaggggttttataaattccataactggtttgatgaccgagcctggtaccctttg
ggacgaatcattggaggaacaatttacccaggtttaatgatcacctctgctgcaatctac
catgtactccattttttccacatcaccatcgacattcggaatgtctgtgtgttcctggcc
cctctcttctcctccttcaccaccatcgtcacgtaccaccttaccaaagagctcaaggat
gcaggggctgggcttcttgctgctgccatgattgctgtagttcctggatatatctcccga
tctgtggctggctcctatgataatgaagggattgccatcttttgcatgctactcacctac
tacatgtggatcaaggcagtaaagactggttccatctgttgggcagctaagtgtgccctt
gcttatttctacatggtctcgtcatggggaggttatgtgttcctgatcaacttaattcct
ctccacgtcctcgtgctgatgctcacaggccgtttctctcaccggatctatgtggcctac
tgtactgtttactgcctgggcactatactttctatgcagatctcctttgtgggtttccag
cctgtcctttcatcagagcacatggcagcctttggggtctttggtctctgccagatccat
gcctttgtggattacctgcgcagcaagttgaatccacaacaatttgaagttcttttccgg
agcgtcatctctctggtaggctttgtccttctcaccgtgggagctctcctcatgctgaca
ggaaaaatatctccctggacggggcgtttctactcgctgctggatccctcttatgctaag
aacaacatccccatcattgcttctgtgtctgagcatcagcccacaacctggtcctcatac
tattttgacctgcagctcctcgtcttcatgtttccagttggcctctattactgctttagc
aacctgtctgatgcccggatttttatcatcatgtatggtgtgaccagcatgtacttttca
gctgtaatggtgcgtctaatgctagtgttggcacctgttatgtgcattctctctggcatt
ggagtctcccaggtgctgtccacatacatgaagaatctggacataagtcgtccagacaag
aagagcaagaagcaacaggattccacctaccctattaagaatgaagtggcaagtgggatg
atactggtcatggctttctttctcatcacctacacctttcattcaacctgggtgaccagt
gaggcctactcttctccgtccattgtactatctgcccgtggtggggatggcagtaggatc
atatttgatgacttccgagaagcatattattggcttcgtcataatactccagaggatgcg
aaggtcatgtcctggtgggattatggctatcagattacagctatggcaaaccgaacaatt
ttagtggacaataacacatggaataatacccatatttctcgagtagggcaggcaatggcg
tccacagaggaaaaagcctatgagatcatgagggagctcgatgtcagctatgtgctggtc
atttttggaggcctcactgggtattcctctgatgatatcaacaagtttctttggatggtc
cggattggagggagcacagatacaggcaaacatatcaaggagaatgactattatactcca
actggggagttccgtgtggaccgtgaaggttctccagtgctgctcaactgcctcatgtac
aagatgtgttactatcgctttggacaggtttacacagaagccaagcgtcctccaggcttt
gaccgtgtccgaaatgctgagattgggaataaagactttgagcttgatgtcctggaggaa
gcatataccacagaacattggctggtcaggatatacaaggtaaaggacctggataatcga
ggcttgtcaaggacataa

DBGET integrated database retrieval system