KEGG   Homo sapiens (human): 3706Help
Entry
3706              CDS       T01001                                 

Gene name
ITPKA, IP3-3KA, IP3KA
Definition
(RefSeq) inositol-trisphosphate 3-kinase A
  KO
K00911  1D-myo-inositol-triphosphate 3-kinase [EC:2.7.1.127]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    3706 (ITPKA)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    3706 (ITPKA)
   04070 Phosphatidylinositol signaling system
    3706 (ITPKA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.127  inositol-trisphosphate 3-kinase
     3706 (ITPKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IPK
Motif
Other DBs
NCBI-GeneID: 3706
NCBI-ProteinID: NP_002211
OMIM: 147521
HGNC: 6178
Ensembl: ENSG00000137825
Vega: OTTHUMG00000130343
Pharos: P23677(Tbio)
UniProt: P23677
Structure
PDB: 

Position
15q15.1
AA seq 461 aa AA seqDB search
MTLPGGPTGMARPGGARPCSPGLERAPRRSVGELRLLFEARCAAVAAAAAAGEPRARGAK
RRGGQVPNGLPRAPPAPVIPQLTVTAEEPDVPPTSPGPPERERDCLPAAGSSHLQQPRRL
STSSVSSTGSSSLLEDSEDDLLSDSESRSRGNVQLEAGEDVGQKNHWQKIRTMVNLPVIS
PFKKRYAWVQLAGHTGSFKAAGTSGLILKRCSEPERYCLARLMADALRGCVPAFHGVVER
DGESYLQLQDLLDGFDGPCVLDCKMGVRTYLEEELTKARERPKLRKDMYKKMLAVDPEAP
TEEEHAQRAVTKPRYMQWREGISSSTTLGFRIEGIKKADGSCSTDFKTTRSREQVLRVFE
EFVQGDEEVLRRYLNRLQQIRDTLEVSEFFRRHEVIGSSLLFVHDHCHRAGVWLIDFGKT
TPLPDGQILDHRRPWEEGNREDGYLLGLDNLIGILASLAER
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcccgggggcccaacgggcatggcgcggccggggggcgcgaggccctgcagc
ccggggctggagcgggccccgcgccggagtgtcggggagctgcgcctgctcttcgaggcg
cgctgtgcggcggtcgctgcggccgccgccgcgggggagccccgggcccgcggggccaag
cggcgtgggggacaggtccccaacgggcttccgcgggctcccccggccccggtgatccct
cagctgaccgtgacagccgaggagcccgacgtgcccccgaccagccctgggccgccggag
cgggagagggactgcctcccggcagcgggctcttcgcacctgcagcagccgcgccgcctt
tccacctcgtcggtctcctccactggctcctcgtcgctgctcgaggactcggaggacgac
ctgctgagcgacagtgagagccggagccgcggcaacgtgcagctggaagcgggcgaggac
gtgggtcagaaaaaccactggcagaagatccggaccatggtcaatctgccggtcataagc
cctttcaagaagcgctacgcctgggtgcagctggcagggcacactgggagttttaaggcg
gcgggcaccagcgggctgatcctgaagcgctgctcggagccggagcgctactgcctggcg
cggctgatggctgacgcgctgcgcggctgcgtgcctgccttccacggcgtggtggagcgc
gacggcgaaagctacctgcagctgcaggacctgctcgatggcttcgacggaccttgtgtg
ctcgactgcaaaatgggcgtcaggacttacctagaggaggagctgaccaaggcccgtgag
cggcccaagctgcggaaggacatgtacaagaaaatgctggcggtggatcctgaagctccc
acggaggaggagcacgcgcagcgcgccgtcaccaagccgcgctacatgcagtggcgggaa
ggcatcagctccagcaccaccctcggcttccgcatcgagggcatcaagaaagcggacggc
tcctgcagcaccgacttcaagactacgcgaagccgagagcaggtgcttcgcgtctttgaa
gagtttgtgcaaggagatgaggaagtgctgaggcggtatctgaaccgcctgcagcagatc
cgggacaccctggaggtatccgagttcttcaggaggcacgaggtgatcggcagctcgctc
ctctttgtgcacgatcactgccatcgcgccggcgtgtggctcatcgacttcggcaagacc
acgcccctccccgatggccagatcctggaccaccggcggccctgggaggagggcaaccgc
gaggacggctatttgctggggctggacaatctcattggcatcctggccagcctggctgag
agatga

DBGET integrated database retrieval system