KEGG   Homo sapiens (human): 3706Help
Entry
3706              CDS       T01001                                 

Gene name
ITPKA, IP3-3KA, IP3KA
Definition
(RefSeq) inositol-trisphosphate 3-kinase A
  KO
K00911  1D-myo-inositol-triphosphate 3-kinase [EC:2.7.1.127]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    3706 (ITPKA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3706 (ITPKA)
   04070 Phosphatidylinositol signaling system
    3706 (ITPKA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.127  inositol-trisphosphate 3-kinase
     3706 (ITPKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IPK
Motif
Other DBs
NCBI-GeneID: 3706
NCBI-ProteinID: NP_002211
OMIM: 147521
HGNC: 6178
Ensembl: ENSG00000137825
Vega: OTTHUMG00000130343
Pharos: P23677(Tbio)
UniProt: P23677
Structure
PDB: 

Position
15q15.1
AA seq 461 aa AA seqDB search
MTLPGGPTGMARPGGARPCSPGLERAPRRSVGELRLLFEARCAAVAAAAAAGEPRARGAK
RRGGQVPNGLPRAPPAPVIPQLTVTAEEPDVPPTSPGPPERERDCLPAAGSSHLQQPRRL
STSSVSSTGSSSLLEDSEDDLLSDSESRSRGNVQLEAGEDVGQKNHWQKIRTMVNLPVIS
PFKKRYAWVQLAGHTGSFKAAGTSGLILKRCSEPERYCLARLMADALRGCVPAFHGVVER
DGESYLQLQDLLDGFDGPCVLDCKMGVRTYLEEELTKARERPKLRKDMYKKMLAVDPEAP
TEEEHAQRAVTKPRYMQWREGISSSTTLGFRIEGIKKADGSCSTDFKTTRSREQVLRVFE
EFVQGDEEVLRRYLNRLQQIRDTLEVSEFFRRHEVIGSSLLFVHDHCHRAGVWLIDFGKT
TPLPDGQILDHRRPWEEGNREDGYLLGLDNLIGILASLAER
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcccgggggcccaacgggcatggcgcggccggggggcgcgaggccctgcagc
ccggggctggagcgggccccgcgccggagtgtcggggagctgcgcctgctcttcgaggcg
cgctgtgcggcggtcgctgcggccgccgccgcgggggagccccgggcccgcggggccaag
cggcgtgggggacaggtccccaacgggcttccgcgggctcccccggccccggtgatccct
cagctgaccgtgacagccgaggagcccgacgtgcccccgaccagccctgggccgccggag
cgggagagggactgcctcccggcagcgggctcttcgcacctgcagcagccgcgccgcctt
tccacctcgtcggtctcctccactggctcctcgtcgctgctcgaggactcggaggacgac
ctgctgagcgacagtgagagccggagccgcggcaacgtgcagctggaagcgggcgaggac
gtgggtcagaaaaaccactggcagaagatccggaccatggtcaatctgccggtcataagc
cctttcaagaagcgctacgcctgggtgcagctggcagggcacactgggagttttaaggcg
gcgggcaccagcgggctgatcctgaagcgctgctcggagccggagcgctactgcctggcg
cggctgatggctgacgcgctgcgcggctgcgtgcctgccttccacggcgtggtggagcgc
gacggcgaaagctacctgcagctgcaggacctgctcgatggcttcgacggaccttgtgtg
ctcgactgcaaaatgggcgtcaggacttacctagaggaggagctgaccaaggcccgtgag
cggcccaagctgcggaaggacatgtacaagaaaatgctggcggtggatcctgaagctccc
acggaggaggagcacgcgcagcgcgccgtcaccaagccgcgctacatgcagtggcgggaa
ggcatcagctccagcaccaccctcggcttccgcatcgagggcatcaagaaagcggacggc
tcctgcagcaccgacttcaagactacgcgaagccgagagcaggtgcttcgcgtctttgaa
gagtttgtgcaaggagatgaggaagtgctgaggcggtatctgaaccgcctgcagcagatc
cgggacaccctggaggtatccgagttcttcaggaggcacgaggtgatcggcagctcgctc
ctctttgtgcacgatcactgccatcgcgccggcgtgtggctcatcgacttcggcaagacc
acgcccctccccgatggccagatcctggaccaccggcggccctgggaggagggcaaccgc
gaggacggctatttgctggggctggacaatctcattggcatcctggccagcctggctgag
agatga

DBGET integrated database retrieval system