KEGG   Homo sapiens (human): 3706Help
Entry
3706              CDS       T01001                                 

Gene name
ITPKA, IP3-3KA, IP3KA
Definition
(RefSeq) inositol-trisphosphate 3-kinase A
  KO
K00911  1D-myo-inositol-triphosphate 3-kinase [EC:2.7.1.127]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    3706 (ITPKA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3706 (ITPKA)
   04070 Phosphatidylinositol signaling system
    3706 (ITPKA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.127  inositol-trisphosphate 3-kinase
     3706 (ITPKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IPK
Motif
Other DBs
NCBI-GeneID: 3706
NCBI-ProteinID: NP_002211
OMIM: 147521
HGNC: 6178
Ensembl: ENSG00000137825
Vega: OTTHUMG00000130343
Pharos: P23677(Tbio)
UniProt: P23677
Structure
PDB: 

Position
15q15.1
AA seq 461 aa AA seqDB search
MTLPGGPTGMARPGGARPCSPGLERAPRRSVGELRLLFEARCAAVAAAAAAGEPRARGAK
RRGGQVPNGLPRAPPAPVIPQLTVTAEEPDVPPTSPGPPERERDCLPAAGSSHLQQPRRL
STSSVSSTGSSSLLEDSEDDLLSDSESRSRGNVQLEAGEDVGQKNHWQKIRTMVNLPVIS
PFKKRYAWVQLAGHTGSFKAAGTSGLILKRCSEPERYCLARLMADALRGCVPAFHGVVER
DGESYLQLQDLLDGFDGPCVLDCKMGVRTYLEEELTKARERPKLRKDMYKKMLAVDPEAP
TEEEHAQRAVTKPRYMQWREGISSSTTLGFRIEGIKKADGSCSTDFKTTRSREQVLRVFE
EFVQGDEEVLRRYLNRLQQIRDTLEVSEFFRRHEVIGSSLLFVHDHCHRAGVWLIDFGKT
TPLPDGQILDHRRPWEEGNREDGYLLGLDNLIGILASLAER
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcccgggggcccaacgggcatggcgcggccggggggcgcgaggccctgcagc
ccggggctggagcgggccccgcgccggagtgtcggggagctgcgcctgctcttcgaggcg
cgctgtgcggcggtcgctgcggccgccgccgcgggggagccccgggcccgcggggccaag
cggcgtgggggacaggtccccaacgggcttccgcgggctcccccggccccggtgatccct
cagctgaccgtgacagccgaggagcccgacgtgcccccgaccagccctgggccgccggag
cgggagagggactgcctcccggcagcgggctcttcgcacctgcagcagccgcgccgcctt
tccacctcgtcggtctcctccactggctcctcgtcgctgctcgaggactcggaggacgac
ctgctgagcgacagtgagagccggagccgcggcaacgtgcagctggaagcgggcgaggac
gtgggtcagaaaaaccactggcagaagatccggaccatggtcaatctgccggtcataagc
cctttcaagaagcgctacgcctgggtgcagctggcagggcacactgggagttttaaggcg
gcgggcaccagcgggctgatcctgaagcgctgctcggagccggagcgctactgcctggcg
cggctgatggctgacgcgctgcgcggctgcgtgcctgccttccacggcgtggtggagcgc
gacggcgaaagctacctgcagctgcaggacctgctcgatggcttcgacggaccttgtgtg
ctcgactgcaaaatgggcgtcaggacttacctagaggaggagctgaccaaggcccgtgag
cggcccaagctgcggaaggacatgtacaagaaaatgctggcggtggatcctgaagctccc
acggaggaggagcacgcgcagcgcgccgtcaccaagccgcgctacatgcagtggcgggaa
ggcatcagctccagcaccaccctcggcttccgcatcgagggcatcaagaaagcggacggc
tcctgcagcaccgacttcaagactacgcgaagccgagagcaggtgcttcgcgtctttgaa
gagtttgtgcaaggagatgaggaagtgctgaggcggtatctgaaccgcctgcagcagatc
cgggacaccctggaggtatccgagttcttcaggaggcacgaggtgatcggcagctcgctc
ctctttgtgcacgatcactgccatcgcgccggcgtgtggctcatcgacttcggcaagacc
acgcccctccccgatggccagatcctggaccaccggcggccctgggaggagggcaaccgc
gaggacggctatttgctggggctggacaatctcattggcatcctggccagcctggctgag
agatga

KEGG   Homo sapiens (human): 3707Help
Entry
3707              CDS       T01001                                 

Gene name
ITPKB, IP3-3KB, IP3K, IP3K-B, IP3KB, PIG37
Definition
(RefSeq) inositol-trisphosphate 3-kinase B
  KO
K00911  1D-myo-inositol-triphosphate 3-kinase [EC:2.7.1.127]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    3707 (ITPKB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3707 (ITPKB)
   04070 Phosphatidylinositol signaling system
    3707 (ITPKB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.127  inositol-trisphosphate 3-kinase
     3707 (ITPKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IPK
Motif
Other DBs
NCBI-GeneID: 3707
NCBI-ProteinID: NP_002212
OMIM: 147522
HGNC: 6179
Ensembl: ENSG00000143772
Vega: OTTHUMG00000037582
Pharos: P27987(Tbio)
UniProt: P27987 B2R9J0
Position
1q42.12
AA seq 946 aa AA seqDB search
MAVYCYALNSLVIMNSANEMKSGGGPGPSGSETPPPPRRAVLSPGSVFSPGRGASFLFPP
AESLSPEEPRSPGGWRSGRRRLNSSSGSGSGSSGSSVSSPSWAGRLRGDRQQVVAAGTLS
PPGPEEAKRKLRILQRELQNVQVNQKVGMFEAHIQAQSSAIQAPRSPRLGRARSPSPCPF
RSSSQPPGRVLVQGARSEERRTKSWGEQCPETSGTDSGRKGGPSLCSSQVKKGMPPLPGR
AAPTGSEAQGPSAFVRMEKGIPASPRCGSPTAMEIDKRGSPTPGTRSCLAPSLGLFGASL
TMATEVAARVTSTGPHRPQDLALTEPSGRARELEDLQPPEALVERQGQFLGSETSPAPER
GGPRDGEPPGKMGKGYLPCGMPGSGEPEVGKRPEETTVSVQSAESSDSLSWSRLPRALAS
VGPEEARSGAPVGGGRWQLSDRVEGGSPTLGLLGGSPSAQPGTGNVEAGIPSGRMLEPLP
CWDAAKDLKEPQCPPGDRVGVQPGNSRVWQGTMEKAGLAWTRGTGVQSEGTWESQRQDSD
ALPSPELLPQDPDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSS
SSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQKPRVSKSWRKIKNMVHWSPF
VMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMVDVLRPFVPAYHGDVV
KDGERYNQMDDLLADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMYQKMIEVDPEA
PTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGTVNRDFKKTKTREQVTEAF
REFTKGNHNILIAYRDRLKAIRTTLEVSPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGK
TTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLVDILTEMSQDAPLA
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgtactgctatgcgctcaatagcctggtgatcatgaatagcgccaacgagatg
aagagcggcggcggcccggggcccagtggcagcgagacgcccccgcccccgaggagggca
gtgctgagccccggcagcgttttcagccccgggagaggcgcctctttcctcttcccccca
gccgagtcgctgtcccccgaggagccccggagccccgggggctggcggagcggccggcgc
aggctgaatagtagcagcggcagtggcagcggcagcagcggcagtagcgtgagcagccca
agttgggctggtcgcctgcgaggggaccggcagcaggtggtggcagccggtaccctctcc
ccgccagggccggaggaggccaagaggaagctgcggatcttgcagcgcgagttgcagaac
gtgcaggtgaaccagaaagtgggcatgtttgaggcgcacatccaggcacagagctccgcc
attcaagcgccccgcagcccgcgtttgggcagggctcgctcgccctccccgtgccccttc
cgcagcagcagtcagccccctggaagggtcctggttcagggcgcccggagcgaggaacgg
aggacaaagtcctggggggagcaatgtccagagacttcaggaaccgactccgggaggaaa
ggagggcccagcctatgctcctcgcaggtgaagaaaggaatgccacctcttcccggccgg
gctgcccctacaggatcagaggctcagggtccatccgcttttgtaaggatggagaagggt
atccctgccagtccccgctgtggctcacccacagctatggaaattgacaaaaggggctct
cctaccccgggaactcggagctgcctagctccctcattggggctgttcggagctagctta
acgatggccacggaagtggcagcgagagttacatccactgggccacaccgtccacaggat
cttgccctcactgagccgtctgggagagcccgtgagcttgaggacctgcagcccccagag
gccctggtggagaggcaggggcagtttctgggcagtgagacaagcccagccccagaaagg
ggcgggccccgcgatggagaaccccctgggaagatggggaaaggatatctgccctgtggc
atgccgggctctggggagcctgaagtgggcaaaaggccagaggagacgactgtgagcgtg
caaagcgcagagtcctctgattccctgagctggtccaggctgcccagggccctggcctcc
gtaggccctgaggaggcccgaagtggggcccccgtgggcggggggcgttggcagctctcc
gacagagtggagggagggtccccaacgctgggcttgcttgggggcagcccctcagcacag
ccggggaccgggaatgtggaggcgggaattccttctggcagaatgctggagcctttgccc
tgttgggacgctgcgaaagatctgaaagaacctcagtgccctcctggggacagggtgggt
gtgcagcctgggaactccagggtttggcagggcaccatggagaaagccggtttggcttgg
acgcgtggcacaggggtgcaatcagaggggacttgggaaagccagcggcaggacagtgat
gccctcccaagtccggagctgctaccccaagatccggacaagcctttcctgaggaaggcc
tgcagccccagcaacatacctgctgtcatcattacagacatgggcacccaggaggatggg
gccttggaggagacgcagggaagccctcggggcaacctgcccctgaggaaactgtcctct
tcctcggcctcctccacgggcttctcctcatcctacgaagactcagaggaggacatctcc
agtgaccctgagcgcaccctggaccccaactcagccttcctgcataccctggaccagcag
aaacctagagtgagcaaatcatggaggaagataaaaaacatggtgcactggtctcccttc
gtcatgtccttcaagaagaagtacccctggatccagctggcaggacacgcagggagtttc
aaggcagctgccaatggcaggatcctgaagaagcactgtgagtcagagcagcgctgcctg
gaccggctgatggtggatgtgctgaggcccttcgtacctgcctaccatggggatgtggtg
aaggacggggagcgctacaaccagatggacgacctgctggccgacttcgactcgccctgt
gtgatggactgcaagatgggaatcaggacctacctggaggaggagctcacgaaggcccgg
aagaagcccagcctgcggaaggacatgtaccagaagatgatcgaggtggaccccgaggcc
cccaccgaggaggaaaaagcacagcgggctgtgaccaagccacggtacatgcagtggcgg
gagaccatcagctccacggccaccctggggttcaggatcgagggaatcaagaaagaagac
ggcaccgtgaaccgggacttcaagaagaccaaaacgagggagcaggtcaccgaggccttc
agagagttcactaaaggaaaccataacatcctgatcgcctatcgggaccggctgaaggcc
attcgaaccactctagaagtttctcccttcttcaagtgccacgaggtcattggcagctcc
ctcctcttcatccacgacaagaaggaacaggccaaagtgtggatgatcgactttgggaaa
accacgcccctgcctgagggccagaccctgcagcatgacgtcccctggcaggaggggaac
cgggaggatggctacctctcggggctcaataacctcgtcgacatcctgaccgagatgtcc
caggatgccccactcgcctga

KEGG   Homo sapiens (human): 80271Help
Entry
80271             CDS       T01001                                 

Gene name
ITPKC, IP3-3KC, IP3KC
Definition
(RefSeq) inositol-trisphosphate 3-kinase C
  KO
K00911  1D-myo-inositol-triphosphate 3-kinase [EC:2.7.1.127]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    80271 (ITPKC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    80271 (ITPKC)
   04070 Phosphatidylinositol signaling system
    80271 (ITPKC)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.127  inositol-trisphosphate 3-kinase
     80271 (ITPKC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IPK
Motif
Other DBs
NCBI-GeneID: 80271
NCBI-ProteinID: NP_079470
OMIM: 606476
HGNC: 14897
Ensembl: ENSG00000086544
Vega: OTTHUMG00000182688
Pharos: Q96DU7(Tbio)
UniProt: Q96DU7 A0A024R0N8
Structure
PDB: 

Position
19q13.2
AA seq 683 aa AA seqDB search
MRRCPCRGSLNEAEAGALPAAARMGLEAPRGGRRRQPGQQRPGPGAGAPAGRPEGGGPWA
RTEGSSLHSEPERAGLGPAPGTESPQAEFWTDGQTEPAAAGLGVETERPKQKTEPDRSSL
RTHLEWSWSELETTCLWTETGTDGLWTDPHRSDLQFQPEEASPWTQPGVHGPWTELETHG
SQTQPERVKSWADNLWTHQNSSSLQTHPEGACPSKEPSADGSWKELYTDGSRTQQDIEGP
WTEPYTDGSQKKQDTEAARKQPGTGGFQIQQDTDGSWTQPSTDGSQTAPGTDCLLGEPED
GPLEEPEPGELLTHLYSHLKCSPLCPVPRLIITPETPEPEAQPVGPPSRVEGGSGGFSSA
SSFDESEDDVVAGGGGASDPEDRSGSKPWKKLKTVLKYSPFVVSFRKHYPWVQLSGHAGN
FQAGEDGRILKRFCQCEQRSLEQLMKDPLRPFVPAYYGMVLQDGQTFNQMEDLLADFEGP
SIMDCKMGSRTYLEEELVKARERPRPRKDMYEKMVAVDPGAPTPEEHAQGAVTKPRYMQW
RETMSSTSTLGFRIEGIKKADGTCNTNFKKTQALEQVTKVLEDFVDGDHVILQKYVACLE
ELREALEISPFFKTHEVVGSSLLFVHDHTGLAKVWMIDFGKTVALPDHQTLSHRLPWAEG
NREDGYLWGLDNMICLLQGLAQS
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgctgcccgtgccgtgggagcctgaacgaggcggaggccggggcgctgcccgcg
gcggcccgcatgggactggaggcgccgcgaggagggcggcggcggcagccgggacagcag
cgacctgggcccggcgcaggggccccggcggggcggccggaggggggcgggccctgggcc
cggacagaggggtccagcctccacagcgagcctgagagggccggcctcgggcctgcgccg
gggacagagagtccgcaggcagaattctggacagacggacagactgagcccgcggcagct
ggccttggagtagagaccgagaggcccaagcaaaagacggagccagacaggtccagcctc
cggacgcatctagaatggagctggtcagagctggagacgacttgtctttggacggagacc
gggacagatggcctttggactgatccgcacaggtccgacctccagtttcagcccgaggag
gccagcccctggacacagccaggggttcatgggccctggacagagctggaaacgcatggg
tcacagactcagccagagagggtcaagtcctgggctgataacctctggacccaccagaac
agttccagcctccagactcacccagaaggagcctgtccctcaaaagagccaagtgctgat
ggctcctggaaagaattgtatactgatggctccaggacacaacaggatattgaaggtccc
tggacagagccatatactgatggctcccagaaaaaacaggatactgaagcagccaggaaa
cagcctggcactggtggtttccaaatacaacaggatactgatggctcctggacacaacct
agcactgacggttcccagacagcacctgggacagactgcctcttgggagagcctgaggat
ggcccattagaggaaccagagcctggagaattgctgactcacctgtactctcacctgaag
tgtagccccctgtgccctgtgccccgcctcatcattacccctgagacccctgagcctgag
gcccagccagtgggacccccctcccgggttgaggggggcagcggcggcttctcctctgcc
tcttctttcgacgagtctgaggatgacgtggtggccgggggcggaggtgccagcgatccc
gaggacaggtctgggagcaaaccctggaagaagctgaagacagttctgaagtattcaccc
tttgtggtctccttccgaaaacactacccttgggtccagctttctggacatgctgggaac
ttccaggcaggagaggatggtcggattctgaaacgtttctgtcagtgtgagcagcgcagc
ctggagcagctgatgaaagacccgctgcgacctttcgtgcctgcctactatggcatggtg
ctgcaggatggccagaccttcaaccagatggaagacctcctggctgactttgagggcccc
tccattatggactgcaagatgggcagcaggacctatctggaagaggagctagtgaaggca
cgggaacgtccccgtccccggaaggacatgtatgagaagatggtggctgtggaccctggg
gcccctacccctgaggagcatgcccagggtgcagtcaccaagccccgctacatgcagtgg
agggaaaccatgagctccacctctaccctgggcttccggatcgagggcatcaagaaggca
gatgggacctgtaacaccaacttcaagaagacgcaggcactggagcaggtgacaaaagtg
ctggaggacttcgtggatggagaccacgtcatcctgcaaaagtacgtggcatgcctagaa
gaacttcgtgaagctctggagatctcccccttcttcaagacccacgaggtggtaggcagc
tccctcctcttcgtgcacgaccacaccggcctggccaaggtctggatgatagacttcggc
aagacggtggccttgcccgaccaccagacgctcagccacaggctgccctgggctgagggc
aaccgtgaggacggctacctctggggcctggacaacatgatctgcctcctgcaggggctg
gcacagagctga

DBGET integrated database retrieval system