KEGG   Homo sapiens (human): 3707Help
Entry
3707              CDS       T01001                                 

Gene name
ITPKB, IP3-3KB, IP3K, IP3K-B, IP3KB, PIG37
Definition
(RefSeq) inositol-trisphosphate 3-kinase B
  KO
K00911  1D-myo-inositol-triphosphate 3-kinase [EC:2.7.1.127]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    3707 (ITPKB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3707 (ITPKB)
   04070 Phosphatidylinositol signaling system
    3707 (ITPKB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.127  inositol-trisphosphate 3-kinase
     3707 (ITPKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IPK
Motif
Other DBs
NCBI-GeneID: 3707
NCBI-ProteinID: NP_002212
OMIM: 147522
HGNC: 6179
Ensembl: ENSG00000143772
Vega: OTTHUMG00000037582
Pharos: P27987(Tbio)
UniProt: P27987 B2R9J0
Position
1q42.12
AA seq 946 aa AA seqDB search
MAVYCYALNSLVIMNSANEMKSGGGPGPSGSETPPPPRRAVLSPGSVFSPGRGASFLFPP
AESLSPEEPRSPGGWRSGRRRLNSSSGSGSGSSGSSVSSPSWAGRLRGDRQQVVAAGTLS
PPGPEEAKRKLRILQRELQNVQVNQKVGMFEAHIQAQSSAIQAPRSPRLGRARSPSPCPF
RSSSQPPGRVLVQGARSEERRTKSWGEQCPETSGTDSGRKGGPSLCSSQVKKGMPPLPGR
AAPTGSEAQGPSAFVRMEKGIPASPRCGSPTAMEIDKRGSPTPGTRSCLAPSLGLFGASL
TMATEVAARVTSTGPHRPQDLALTEPSGRARELEDLQPPEALVERQGQFLGSETSPAPER
GGPRDGEPPGKMGKGYLPCGMPGSGEPEVGKRPEETTVSVQSAESSDSLSWSRLPRALAS
VGPEEARSGAPVGGGRWQLSDRVEGGSPTLGLLGGSPSAQPGTGNVEAGIPSGRMLEPLP
CWDAAKDLKEPQCPPGDRVGVQPGNSRVWQGTMEKAGLAWTRGTGVQSEGTWESQRQDSD
ALPSPELLPQDPDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSS
SSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQKPRVSKSWRKIKNMVHWSPF
VMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMVDVLRPFVPAYHGDVV
KDGERYNQMDDLLADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMYQKMIEVDPEA
PTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGTVNRDFKKTKTREQVTEAF
REFTKGNHNILIAYRDRLKAIRTTLEVSPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGK
TTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLVDILTEMSQDAPLA
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgtactgctatgcgctcaatagcctggtgatcatgaatagcgccaacgagatg
aagagcggcggcggcccggggcccagtggcagcgagacgcccccgcccccgaggagggca
gtgctgagccccggcagcgttttcagccccgggagaggcgcctctttcctcttcccccca
gccgagtcgctgtcccccgaggagccccggagccccgggggctggcggagcggccggcgc
aggctgaatagtagcagcggcagtggcagcggcagcagcggcagtagcgtgagcagccca
agttgggctggtcgcctgcgaggggaccggcagcaggtggtggcagccggtaccctctcc
ccgccagggccggaggaggccaagaggaagctgcggatcttgcagcgcgagttgcagaac
gtgcaggtgaaccagaaagtgggcatgtttgaggcgcacatccaggcacagagctccgcc
attcaagcgccccgcagcccgcgtttgggcagggctcgctcgccctccccgtgccccttc
cgcagcagcagtcagccccctggaagggtcctggttcagggcgcccggagcgaggaacgg
aggacaaagtcctggggggagcaatgtccagagacttcaggaaccgactccgggaggaaa
ggagggcccagcctatgctcctcgcaggtgaagaaaggaatgccacctcttcccggccgg
gctgcccctacaggatcagaggctcagggtccatccgcttttgtaaggatggagaagggt
atccctgccagtccccgctgtggctcacccacagctatggaaattgacaaaaggggctct
cctaccccgggaactcggagctgcctagctccctcattggggctgttcggagctagctta
acgatggccacggaagtggcagcgagagttacatccactgggccacaccgtccacaggat
cttgccctcactgagccgtctgggagagcccgtgagcttgaggacctgcagcccccagag
gccctggtggagaggcaggggcagtttctgggcagtgagacaagcccagccccagaaagg
ggcgggccccgcgatggagaaccccctgggaagatggggaaaggatatctgccctgtggc
atgccgggctctggggagcctgaagtgggcaaaaggccagaggagacgactgtgagcgtg
caaagcgcagagtcctctgattccctgagctggtccaggctgcccagggccctggcctcc
gtaggccctgaggaggcccgaagtggggcccccgtgggcggggggcgttggcagctctcc
gacagagtggagggagggtccccaacgctgggcttgcttgggggcagcccctcagcacag
ccggggaccgggaatgtggaggcgggaattccttctggcagaatgctggagcctttgccc
tgttgggacgctgcgaaagatctgaaagaacctcagtgccctcctggggacagggtgggt
gtgcagcctgggaactccagggtttggcagggcaccatggagaaagccggtttggcttgg
acgcgtggcacaggggtgcaatcagaggggacttgggaaagccagcggcaggacagtgat
gccctcccaagtccggagctgctaccccaagatccggacaagcctttcctgaggaaggcc
tgcagccccagcaacatacctgctgtcatcattacagacatgggcacccaggaggatggg
gccttggaggagacgcagggaagccctcggggcaacctgcccctgaggaaactgtcctct
tcctcggcctcctccacgggcttctcctcatcctacgaagactcagaggaggacatctcc
agtgaccctgagcgcaccctggaccccaactcagccttcctgcataccctggaccagcag
aaacctagagtgagcaaatcatggaggaagataaaaaacatggtgcactggtctcccttc
gtcatgtccttcaagaagaagtacccctggatccagctggcaggacacgcagggagtttc
aaggcagctgccaatggcaggatcctgaagaagcactgtgagtcagagcagcgctgcctg
gaccggctgatggtggatgtgctgaggcccttcgtacctgcctaccatggggatgtggtg
aaggacggggagcgctacaaccagatggacgacctgctggccgacttcgactcgccctgt
gtgatggactgcaagatgggaatcaggacctacctggaggaggagctcacgaaggcccgg
aagaagcccagcctgcggaaggacatgtaccagaagatgatcgaggtggaccccgaggcc
cccaccgaggaggaaaaagcacagcgggctgtgaccaagccacggtacatgcagtggcgg
gagaccatcagctccacggccaccctggggttcaggatcgagggaatcaagaaagaagac
ggcaccgtgaaccgggacttcaagaagaccaaaacgagggagcaggtcaccgaggccttc
agagagttcactaaaggaaaccataacatcctgatcgcctatcgggaccggctgaaggcc
attcgaaccactctagaagtttctcccttcttcaagtgccacgaggtcattggcagctcc
ctcctcttcatccacgacaagaaggaacaggccaaagtgtggatgatcgactttgggaaa
accacgcccctgcctgagggccagaccctgcagcatgacgtcccctggcaggaggggaac
cgggaggatggctacctctcggggctcaataacctcgtcgacatcctgaccgagatgtcc
caggatgccccactcgcctga

DBGET integrated database retrieval system