KEGG   Homo sapiens (human): 3713Help
Entry
3713              CDS       T01001                                 

Gene name
IVL
Definition
(RefSeq) involucrin
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Involucrin_N Involucrin
Motif
Other DBs
NCBI-GeneID: 3713
NCBI-ProteinID: NP_005538
OMIM: 147360
HGNC: 6187
Ensembl: ENSG00000163207
Vega: OTTHUMG00000012451
Pharos: P07476(Tbio)
UniProt: P07476
Position
1q21.3
AA seq 585 aa AA seqDB search
MSQQHTLPVTLSPALSQELLKTVPPPVNTHQEQMKQPTPLPPPCQKVPVELPVEVPSKQE
EKHMTAVKGLPEQECEQQQKEPQEQELQQQHWEQHEEYQKAENPEQQLKQEKTQRDQQLN
KQLEEEKKLLDQQLDQELVKRDEQLGMKKEQLLELPEQQEGHLKHLEQQEGQLKHPEQQE
GQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPQQQE
GQLELSEQQEGQLELSEQQEGQLKHLEHQEGQLEVPEEQMGQLKYLEQQEGQLKHLDQQE
KQPELPEQQMGQLKHLEQQEGQPKHLEQQEGQLEQLEEQEGQLKHLEQQEGQLEHLEHQE
GQLGLPEQQVLQLKQLEKQQGQPKHLEEEEGQLKHLVQQEGQLKHLVQQEGQLEQQERQV
EHLEQQVGQLKHLEEQEGQLKHLEQQQGQLEVPEQQVGQPKNLEQEEKQLELPEQQEGQV
KHLEKQEAQLELPEQQVGQPKHLEQQEKHLEHPEQQDGQLKHLEQQEGQLKDLEQQKGQL
EQPVFAPAPGQVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagcaacacacactgccagtgaccctctcccctgccctcagtcaggagctcctc
aagactgttcctcctccagtcaatacccatcaggagcaaatgaaacagccaactccactg
cctcccccatgccagaaggtgcctgtcgagctcccagtggaggtcccatcaaagcaagag
gaaaagcacatgactgctgtaaagggactgcctgagcaagaatgtgagcaacagcagaag
gagccacaggagcaggagctgcagcaacagcactgggaacagcatgaggaatatcagaaa
gcagaaaacccagagcagcagcttaagcaggagaaaacacaaagggatcagcagctaaac
aaacagctggaagaagagaagaagctcttagaccagcaactggatcaagagctagtcaag
agagatgagcaactgggaatgaagaaagagcaactgttggagctcccagagcagcaggag
gggcacctgaagcacctagagcagcaggagggacagctgaagcacccggagcagcaggag
gggcagctggagctcccagagcagcaggaggggcagctggagctcccagagcagcaggag
gggcagctggagctcccagagcagcaggaggggcagctggagctcccagagcagcaggag
gggcagctggagctcccagagcagcaggaggggcagctggagctcccacagcagcaggag
gggcagctggagctctctgagcagcaggaggggcagctggagctctctgagcagcaggag
ggacagctgaagcacctggagcaccaggaggggcagctggaggtcccagaggagcagatg
gggcagctgaagtacctggaacagcaggaggggcagctgaagcacctggatcagcaggag
aagcagccagagctcccagagcagcagatggggcagctgaagcacctggagcagcaggag
gggcagcctaagcatctggagcagcaggaggggcaactggagcagctggaggagcaggag
gggcagctgaagcacctggagcagcaggaggggcagctggagcacctggagcaccaggaa
gggcagctggggctcccagagcagcaggtgctgcagctgaagcagctagagaagcagcag
gggcagccaaagcacctggaggaggaggaggggcagctgaagcacctggtgcagcaggag
gggcagctgaagcatctggtgcagcaggaggggcagctggagcagcaggagaggcaggtg
gagcacctggagcagcaggtggggcagctgaagcacctagaggagcaggagggacaactg
aagcatctggagcagcagcaggggcagttggaggtcccagagcagcaggtggggcagcca
aagaacctggagcaggaggagaagcaactggagctcccagagcagcaagagggccaggtg
aagcacctggagaagcaggaggcacagctggagctcccagagcagcaggtaggacagcca
aagcacctggaacagcaggaaaagcacctagagcacccagagcagcaggacggacaacta
aaacatctggagcagcaggaggggcagctgaaggacctggagcagcagaaggggcagctg
gagcagcctgtgtttgccccagctccaggccaggtccaagacattcaaccagccctgccc
acaaagggagaagtattgcttcctgtagagcaccagcagcagaagcaggaggtgcagtgg
ccacccaaacataaataa

DBGET integrated database retrieval system