KEGG   Homo sapiens (human): 3717Help
Entry
3717              CDS       T01001                                 

Gene name
JAK2, JTK10, THCYT3
Definition
(RefSeq) Janus kinase 2
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04062  Chemokine signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04725  Cholinergic synapse
hsa04917  Prolactin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05164  Influenza A
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05200  Pathways in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Network
nt06119  JAK-STAT signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00181  KSHV vIL-6 to Jak-STAT signaling pathway
Disease
H00012  Polycythemia vera
H01433  Budd-Chiari syndrome
H01481  Myelodysplastic syndrome
H01605  Myelofibrosis
H01612  Essential thrombocytosis
Drug target
Atiprimod (DG02069): D03003 D03004
Baricitinib: D10308
Delgocitinib: D11046
Fedratinib (DG02968): D10630 D11296
Gandotinib: D10365
Momelotinib (DG01366): D10315 D10358
Peficitinib (DG01853): D10653 D10721
Ruxolitinib (DG00719): D09959 D09960
Tofacitinib (DG00742): D09783 D09970
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3717 (JAK2)
   04151 PI3K-Akt signaling pathway
    3717 (JAK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3717 (JAK2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3717 (JAK2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    3717 (JAK2)
   04659 Th17 cell differentiation
    3717 (JAK2)
   04062 Chemokine signaling pathway
    3717 (JAK2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    3717 (JAK2)
   04917 Prolactin signaling pathway
    3717 (JAK2)
  09156 Nervous system
   04725 Cholinergic synapse
    3717 (JAK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3717 (JAK2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    3717 (JAK2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    3717 (JAK2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3717 (JAK2)
  09172 Infectious disease: viral
   05164 Influenza A
    3717 (JAK2)
   05161 Hepatitis B
    3717 (JAK2)
   05168 Herpes simplex virus 1 infection
    3717 (JAK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3717 (JAK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3717 (JAK2)
   05140 Leishmaniasis
    3717 (JAK2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    3717 (JAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    3717 (JAK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     3717 (JAK2)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   3717 (JAK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase FERM_F2 FERM_F1 Jak1_Phl SH2 FERM_M Kinase-like RIO1
Motif
Other DBs
NCBI-GeneID: 3717
NCBI-ProteinID: NP_001309123
OMIM: 147796
HGNC: 6192
Ensembl: ENSG00000096968
Vega: OTTHUMG00000019490
Pharos: O60674(Tclin)
UniProt: O60674
Structure
PDB: 

Position
9p24.1
AA seq 1132 aa AA seqDB search
MGMACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSG
EYVAEEICIAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHNVLYRIRFYF
PRWYCSGSNRAYRHGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLG
MAVLDMMRIAKENDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQF
SQCKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGKNLEIELSSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIQSNCHGPISMDFAISKLKKAGNQT
GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNC
YQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKI
RNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSKLSHKHLVLNYGVCVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWA
MHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP
PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAEL
ANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIE
LLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
NT seq 3399 nt NT seq  +upstreamnt  +downstreamnt
atgggaatggcctgccttacgatgacagaaatggagggaacatccacctcttctatatat
cagaatggtgatatttctggaaatgccaattctatgaagcaaatagatccagttcttcag
gtgtatctttaccattcccttgggaaatctgaggcagattatctgacctttccatctggg
gagtatgttgcagaagaaatctgtattgctgcttctaaagcttgtggtatcacacctgtg
tatcataatatgtttgctttaatgagtgaaacagaaaggatctggtatccacccaaccat
gtcttccatatagatgagtcaaccaggcataatgtactctacagaataagattttacttt
cctcgttggtattgcagtggcagcaacagagcctatcggcatggaatatctcgaggtgct
gaagctcctcttcttgatgactttgtcatgtcttacctctttgctcagtggcggcatgat
tttgtgcacggatggataaaagtacctgtgactcatgaaacacaggaagaatgtcttggg
atggcagtgttagatatgatgagaatagccaaagaaaacgatcaaaccccactggccatc
tataactctatcagctacaagacattcttaccaaaatgtattcgagcaaagatccaagac
tatcatattttgacaaggaagcgaataaggtacagatttcgcagatttattcagcaattc
agccaatgcaaagccactgccagaaacttgaaacttaagtatcttataaatctggaaact
ctgcagtctgccttctacacagagaaatttgaagtaaaagaacctggaagtggtccttca
ggtgaggagatttttgcaaccattataataactggaaacggtggaattcagtggtcaaga
gggaaacataaagaaagtgagacactgacagaacaggatttacagttatattgcgatttt
cctaatattattgatgtcagtattaagcaagcaaaccaagagggttcaaatgaaagccga
gttgtaactatccataagcaagatggtaaaaatctggaaattgaacttagctcattaagg
gaagctttgtctttcgtgtcattaattgatggatattatagattaactgcagatgcacat
cattacctctgtaaagaagtagcacctccagccgtgcttgaaaatatacaaagcaactgt
catggcccaatttcgatggattttgccattagtaaactgaagaaagcaggtaatcagact
ggactgtatgtacttcgatgcagtcctaaggactttaataaatattttttgacttttgct
gtcgagcgagaaaatgtcattgaatataaacactgtttgattacaaaaaatgagaatgaa
gagtacaacctcagtgggacaaagaagaacttcagcagtcttaaagatcttttgaattgt
taccagatggaaactgttcgctcagacaatataattttccagtttactaaatgctgtccc
ccaaagccaaaagataaatcaaaccttctagtcttcagaacgaatggtgtttctgatgta
ccaacctcaccaacattacagaggcctactcatatgaaccaaatggtgtttcacaaaatc
agaaatgaagatttgatatttaatgaaagccttggccaaggcacttttacaaagattttt
aaaggcgtacgaagagaagtaggagactacggtcaactgcatgaaacagaagttctttta
aaagttctggataaagcacacagaaactattcagagtctttctttgaagcagcaagtatg
atgagcaagctttctcacaagcatttggttttaaattatggagtatgtgtctgtggagac
gagaatattctggttcaggagtttgtaaaatttggatcactagatacatatctgaaaaag
aataaaaattgtataaatatattatggaaacttgaagttgctaaacagttggcatgggcc
atgcattttctagaagaaaacacccttattcatgggaatgtatgtgccaaaaatattctg
cttatcagagaagaagacaggaagacaggaaatcctcctttcatcaaacttagtgatcct
ggcattagtattacagttttgccaaaggacattcttcaggagagaataccatgggtacca
cctgaatgcattgaaaatcctaaaaatttaaatttggcaacagacaaatggagttttggt
accactttgtgggaaatctgcagtggaggagataaacctctaagtgctctggattctcaa
agaaagctacaattttatgaagataggcatcagcttcctgcaccaaagtgggcagaatta
gcaaaccttataaataattgtatggattatgaaccagatttcaggccttctttcagagcc
atcatacgagatcttaacagtttgtttactccagattatgaactattaacagaaaatgac
atgttaccaaatatgaggataggtgccctggggttttctggtgcctttgaagaccgggat
cctacacagtttgaagagagacatttgaaatttctacagcaacttggcaagggtaatttt
gggagtgtggagatgtgccggtatgaccctctacaggacaacactggggaggtggtcgct
gtaaaaaagcttcagcatagtactgaagagcacctaagagactttgaaagggaaattgaa
atcctgaaatccctacagcatgacaacattgtaaagtacaagggagtgtgctacagtgct
ggtcggcgtaatctaaaattaattatggaatatttaccatatggaagtttacgagactat
cttcaaaaacataaagaacggatagatcacataaaacttctgcagtacacatctcagata
tgcaagggtatggagtatcttggtacaaaaaggtatatccacagggatctggcaacgaga
aatatattggtggagaacgagaacagagttaaaattggagattttgggttaaccaaagtc
ttgccacaagacaaagaatactataaagtaaaagaacctggtgaaagtcccatattctgg
tatgctccagaatcactgacagagagcaagttttctgtggcctcagatgtttggagcttt
ggagtggttctgtatgaacttttcacatacattgagaagagtaaaagtccaccagcggaa
tttatgcgtatgattggcaatgacaaacaaggacagatgatcgtgttccatttgatagaa
cttttgaagaataatggaagattaccaagaccagatggatgcccagatgagatctatatg
atcatgacagaatgctggaacaataatgtaaatcaacgcccctcctttagggatctagct
cttcgagtggatcaaataagggataacatggctggatga

DBGET integrated database retrieval system