KEGG   Homo sapiens (human): 3725Help
Entry
3725              CDS       T01001                                 

Gene name
JUN, AP-1, AP1, c-Jun, p39
Definition
(RefSeq) Jun proto-oncogene, AP-1 transcription factor subunit
  KO
K04448  transcription factor AP-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04024  cAMP signaling pathway
hsa04137  Mitophagy - animal
hsa04210  Apoptosis
hsa04310  Wnt signaling pathway
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05161  Hepatitis B
hsa05164  Influenza A
hsa05166  HTLV-I infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05224  Breast cancer
hsa05231  Choline metabolism in cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05323  Rheumatoid arthritis
hsa05418  Fluid shear stress and atherosclerosis
Network
N00157  KSHV vGPCR to GNB/G-ERK signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00189  KSHV K15 to JNK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3725 (JUN)
   04012 ErbB signaling pathway
    3725 (JUN)
   04310 Wnt signaling pathway
    3725 (JUN)
   04668 TNF signaling pathway
    3725 (JUN)
   04024 cAMP signaling pathway
    3725 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    3725 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    3725 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3725 (JUN)
   04530 Tight junction
    3725 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3725 (JUN)
   04621 NOD-like receptor signaling pathway
    3725 (JUN)
   04625 C-type lectin receptor signaling pathway
    3725 (JUN)
   04660 T cell receptor signaling pathway
    3725 (JUN)
   04658 Th1 and Th2 cell differentiation
    3725 (JUN)
   04659 Th17 cell differentiation
    3725 (JUN)
   04657 IL-17 signaling pathway
    3725 (JUN)
   04662 B cell receptor signaling pathway
    3725 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    3725 (JUN)
   04915 Estrogen signaling pathway
    3725 (JUN)
   04921 Oxytocin signaling pathway
    3725 (JUN)
   04926 Relaxin signaling pathway
    3725 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    3725 (JUN)
  09158 Development
   04380 Osteoclast differentiation
    3725 (JUN)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    3725 (JUN)
   05231 Choline metabolism in cancer
    3725 (JUN)
   05203 Viral carcinogenesis
    3725 (JUN)
   05210 Colorectal cancer
    3725 (JUN)
   05211 Renal cell carcinoma
    3725 (JUN)
   05224 Breast cancer
    3725 (JUN)
  09162 Immune diseases
   05323 Rheumatoid arthritis
    3725 (JUN)
   05321 Inflammatiory bowel disease (IBD)
    3725 (JUN)
  09164 Substance dependence
   05030 Cocaine addiction
    3725 (JUN)
   05031 Amphetamine addiction
    3725 (JUN)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    3725 (JUN)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3725 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    3725 (JUN)
  09167 Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    3725 (JUN)
   05132 Salmonella infection
    3725 (JUN)
   05133 Pertussis
    3725 (JUN)
   05166 HTLV-I infection
    3725 (JUN)
   05164 Influenza A
    3725 (JUN)
   05161 Hepatitis B
    3725 (JUN)
   05168 Herpes simplex infection
    3725 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3725 (JUN)
   05169 Epstein-Barr virus infection
    3725 (JUN)
   05140 Leishmaniasis
    3725 (JUN)
   05142 Chagas disease (American trypanosomiasis)
    3725 (JUN)
  09168 Drug resistance
   01522 Endocrine resistance
    3725 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3725 (JUN)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    3725 (JUN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha Jnk-SapK_ap_N FlaC_arch NBP1 Mnd1 TSC22 DUF3450 TFIIA
Motif
Other DBs
NCBI-GeneID: 3725
NCBI-ProteinID: NP_002219
OMIM: 165160
HGNC: 6204
Ensembl: ENSG00000177606
Vega: OTTHUMG00000008376
Pharos: P05412(Tchem)
UniProt: P05412
Structure
PDB: 

Position
1p32.1
AA seq 331 aa AA seqDB search
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctatgacgatgccctcaacgcctcgttcctcccg
tccgagagcggaccttatggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccagtggggagcctgaagccgcacctccgcgccaagaactcggacctc
ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata
atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc
aagaacgtgacagatgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcaacggggca
ggcatggtggctcccgcggtagcctcggtggcagggggcagcggcagcggcggcttcagc
gccagcctgcacagcgagccgccggtctacgcaaacctcagcaacttcaacccaggcgcg
ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcaa
ccccagcagcagcagcagccgccgcaccacctgccccagcagatgcccgtgcagcacccg
cggctgcaggccctgaaggaggagcctcagacagtgcccgagatgcccggcgagacaccg
cccctgtcccccatcgacatggagtcccaggagcggatcaaggcggagaggaagcgcatg
aggaaccgcatcgctgcctccaagtgccgaaaaaggaagctggagagaatcgcccggctg
gaggaaaaagtgaaaaccttgaaagctcagaactcggagctggcgtccacggccaacatg
ctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaacagtgggtgc
caactcatgctaacgcagcagttgcaaacattttga

DBGET integrated database retrieval system