KEGG   Homo sapiens (human): 3726Help
Entry
3726              CDS       T01001                                 

Gene name
JUNB, AP-1
Definition
(RefSeq) JunB proto-oncogene, AP-1 transcription factor subunit
  KO
K09028  transcription factor jun-B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
hsa04668  TNF signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
Disease
H01463  Mycosis fungoides
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    3726 (JUNB)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    3726 (JUNB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    3726 (JUNB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3726 (JUNB)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    3726 (JUNB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf Jnk-SapK_ap_N ZapB PspA_IM30 MAD DUF737
Motif
Other DBs
NCBI-GeneID: 3726
NCBI-ProteinID: NP_002220
OMIM: 165161
HGNC: 6205
Ensembl: ENSG00000171223
Vega: OTTHUMG00000180373
Pharos: P17275(Tbio)
UniProt: P17275 Q5U079
Position
19p13.13
AA seq 347 aa AA seqDB search
MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGP
EGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGG
AGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPP
VYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFK
EEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKV
KTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtgcactaaaatggaacagcccttctaccacgacgactcatacacagctacgggatac
ggccgggcccctggtggcctctctctacacgactacaaactcctgaaaccgagcctggcg
gtcaacctggccgacccctaccggagtctcaaagcgcctggggctcgcggacccggccca
gagggcggcggtggcggcagctacttttctggtcagggctcggacaccggcgcgtctctc
aagctcgcctcttcggagctggaacgcctgattgtccccaacagcaacggcgtgatcacg
acgacgcctacacccccgggacagtacttttacccccgcgggggtggcagcggtggaggt
gcagggggcgcagggggcggcgtcaccgaggagcaggagggcttcgccgacggctttgtc
aaagccctggacgatctgcacaagatgaaccacgtgacaccccccaacgtgtccctgggc
gctaccggggggcccccggctgggcccgggggcgtctacgccggcccggagccacctccc
gtttacaccaacctcagcagctactccccagcctctgcgtcctcgggaggcgccggggct
gccgtcgggaccgggagctcgtacccgacgaccaccatcagctacctcccacacgcgccg
cccttcgccggtggccacccggcgcagctgggcttgggccgcggcgcctccaccttcaag
gaggaaccgcagaccgtgccggaggcgcgcagccgggacgccacgccgccggtgtccccc
atcaacatggaagaccaagagcgcatcaaagtggagcgcaagcggctgcggaaccggctg
gcggccaccaagtgccggaagcggaagctggagcgcatcgcgcgcctggaggacaaggtg
aagacgctcaaggccgagaacgcggggctgtcgagtaccgccggcctcctccgggagcag
gtggcccagctcaaacagaaggtcatgacccacgtcagcaacggctgtcagctgctgctt
ggggtcaagggacacgccttctga

DBGET integrated database retrieval system