KEGG   Homo sapiens (human): 3727Help
Entry
3727              CDS       T01001                                 

Gene name
JUND, AP-1
Definition
(RefSeq) JunD proto-oncogene, AP-1 transcription factor subunit
  KO
K04449  transcription factor jun-D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04380  Osteoclast differentiation
hsa04657  IL-17 signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3727 (JUND)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    3727 (JUND)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    3727 (JUND)
  09158 Development
   04380 Osteoclast differentiation
    3727 (JUND)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3727 (JUND)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    3727 (JUND)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 ZapB TSC22 Jnk-SapK_ap_N DUF3450 FlaC_arch Fib_alpha Mnd1
Motif
Other DBs
NCBI-GeneID: 3727
NCBI-ProteinID: NP_005345
OMIM: 165162
HGNC: 6206
Ensembl: ENSG00000130522
Vega: OTTHUMG00000183355
Pharos: P17535(Tbio)
UniProt: P17535
Structure
PDB: 

Position
19p13.11
AA seq 347 aa AA seqDB search
METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAA
ALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTS
SQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPG
ELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALK
DEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKV
KTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacccttctacggcgatgaggcgctgagcggcctgggcggcggcgccagtggc
agcggcggcagcttcgcgtccccgggccgcttgttccccggggcgcccccgacggccgcg
gccggcagcatgatgaagaaggacgcgctgacgctgagcctgagtgagcaggtggcggca
gcgctcaagcctgcggccgcgccgcctcctacccccctgcgcgccgacggcgcccccagc
gcggcaccccccgacggcctgctcgcctctcccgacctggggctgctgaagctggcctcc
cccgagctcgagcgcctcatcatccagtccaacgggctggtcaccaccacgccgacgagc
tcacagttcctctaccccaaggtggcggccagcgaggagcaggagttcgccgagggcttc
gtcaaggccctggaggatttacacaagcagaaccagctcggcgcgggcgcggccgctgcc
gccgccgccgccgccgccggggggccctcgggcacggccacgggctccgcgccccccggc
gagctggccccggcggcggccgcgcccgaagcgcctgtctacgcgaacctgagcagctac
gcgggcggcgccgggggcgcggggggcgccgcgacggtcgccttcgctgccgaacctgtg
cccttcccgccgccgccacccccaggcgcgttggggccgccgcgcctggctgcgctcaag
gacgagccacagacggtgcccgacgtgccgagcttcggcgagagcccgccgttgtcgccc
atcgacatggacacgcaggagcgcatcaaggcggagcgcaagcggctgcgcaaccgcatc
gccgcctccaagtgccgcaagcgcaagctggagcgcatctcgcgcctggaagagaaagtg
aagaccctcaagagtcagaacacggagctggcgtccacggcgagcctgctgcgcgagcag
gtggcgcagctcaagcagaaagtcctcagccacgtcaacagcggctgccagctgctgccc
cagcaccaggtgcccgcgtactga

DBGET integrated database retrieval system