KEGG   Homo sapiens (human): 3738Help
Entry
3738              CDS       T01001                                 

Gene name
KCNA3, HGK5, HLK3, HPCN3, HUKIII, KV1.3, MK3, PCN3
Definition
(RefSeq) potassium voltage-gated channel subfamily A member 3
  KO
K04876  potassium voltage-gated channel Shaker-related subfamily A member 3
Organism
hsa  Homo sapiens (human)
Drug target
Amifampridine: D10228 D10689
Fampridine: D04127
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3738 (KCNA3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   3738 (KCNA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 PKD_channel
Motif
Other DBs
NCBI-GeneID: 3738
NCBI-ProteinID: NP_002223
OMIM: 176263
HGNC: 6221
Ensembl: ENSG00000177272
Vega: OTTHUMG00000034493
Pharos: P22001(Tclin)
UniProt: P22001
Structure
PDB: 

Position
1p13.3
AA seq 575 aa AA seqDB search
MDERLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNHGYAEPAAGRELPPDMTVVPGDH
LLEPEVADGGGAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLK
TLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIF
SEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVS
VLVILISIVIFCLETLPEFRDEKDYPASTSQDSFEAAGNSTSGSRAGASSFSDPFFVVET
LCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSL
AILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAE
ADDPTSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIV
SNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHS
AFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggacgagcgcctcagccttctgcgctcgccgccgccgccctcagcccgccaccgcgcc
caccctcctcagcgcccagcgagcagcggcggtgcccacacgctggtgaaccacggctac
gcggagcccgccgcaggccgcgagctgccgcccgacatgaccgtggtgcccggggaccac
ctgctggagccggaggtggccgatggtggaggggccccgcctcaaggcggctgtggcggc
ggcggctgcgaccgctacgagccgctgccgccctcactgccggccgcgggcgagcaggac
tgctgcggggagcgcgtggtcatcaacatctccgggctgcgcttcgagacgcagctgaag
accctttgccagttccccgagacgctgctgggcgaccccaagcggcgcatgaggtacttc
gacccgctccgcaacgagtacttcttcgaccgcaaccggcccagcttcgacgccatcctc
tactactatcagtccgggggccgcatccgccggccggtcaacgtgcccatcgacattttc
tccgaggagatccgcttctaccagctgggcgaggaggccatggagaagttccgcgaggac
gagggcttcctgcgggaggaggagcggcccttgccccgccgcgacttccagcgccaggtg
tggctgctcttcgagtaccccgagagctccgggccggcccggggcatcgccatcgtgtcc
gtgctggtcatcctcatctccattgtcatcttctgcctggagacgctgccggagttccgc
gacgagaaggactaccccgcctcgacgtcgcaggactcattcgaagcagccggcaacagc
acgtcggggtcccgcgcaggagcctccagcttctccgatcccttcttcgtggtggagacg
ctgtgcatcatctggttctccttcgaactgctggtgcggttcttcgcttgtcctagcaaa
gccaccttctcgcgaaacatcatgaacctgatcgacattgtggccatcattccttatttt
atcactctgggtaccgagctggccgaacgacagggcaatggacagcaggccatgtctctg
gccatcctgagggtcatccgcctggtaagggtcttccgcatcttcaagctgtcgcgccac
tccaaggggctgcagatcctcgggcaaacgctgaaggcgtccatgcgggagctgggattg
ctcatcttcttcctctttattggggtcatccttttctccagcgcggtctactttgccgag
gcagacgaccccacttcaggtttcagcagcatcccggatgccttctggtgggcagtggta
accatgacaacagtgggttacggcgatatgcacccagtgaccatagggggcaagattgtg
ggatctctctgtgccatcgccggtgtcttgaccatcgcattgccagttcccgtgattgtt
tccaacttcaattacttctaccaccgggagacagaaggggaagagcaatcccagtacatg
cacgtgggaagttgccagcacctctcctcttcagccgaggagctccgaaaagcaaggagt
aactcgactctgagtaagtcggagtatatggtgatcgaagaggggggtatgaaccatagc
gctttcccccagacccctttcaaaacgggcaattccactgccacctgcaccacgaacaat
aatcccaactcttgtgtcaacatcaaaaagatattcaccgatgtttaa

DBGET integrated database retrieval system