KEGG   Homo sapiens (human): 3739Help
Entry
3739              CDS       T01001                                 

Gene name
KCNA4, HBK4, HK1, HPCN2, HUKII, KCNA4L, KCNA8, KV1.4, PCN2
Definition
(RefSeq) potassium voltage-gated channel subfamily A member 4
  KO
K04877  potassium voltage-gated channel Shaker-related subfamily A member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04927  Cortisol synthesis and secretion
hsa04934  Cushing syndrome
Drug target
Amifampridine: D10228 D10689
Fampridine: D04127
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    3739 (KCNA4)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    3739 (KCNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3739 (KCNA4)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   3739 (KCNA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans K_channel_TID BTB_2 Ion_trans_2 DctQ PKD_channel
Motif
Other DBs
NCBI-GeneID: 3739
NCBI-ProteinID: NP_002224
OMIM: 176266
HGNC: 6222
Ensembl: ENSG00000182255
Vega: OTTHUMG00000166144
Pharos: P22459(Tclin)
UniProt: P22459
Structure
PDB: 

Position
11p14.1
AA seq 653 aa AA seqDB search
MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGSGGSGGG
SHHHHQSRGACTSHDPQSSRGSRRRRRQRSEKKKAHYRQSSFPHCSDLMPSGSEEKILRE
LSEEEEDEEEEEEEEEEGRFYYSEDDHGDECSYTDLLPQDEGGGGYSSVRYSDCCERVVI
NVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQSGGR
LKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEYP
ESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLVMALSAGGHGGLLNDTSAPHLE
NSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITLG
TDLAQQQGGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGL
LIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKIV
GSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSS
TSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETDV
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggaggttgcaatggtgagtgcggagagctcagggtgcaacagtcacatgccttatggt
tatgctgcccaggcccgggcccgggagcgggagaggcttgctcactccagggcagctgca
gcagctgctgttgcagcggccacagctgctgtcgaaggtagcgggggttctggtgggggc
tcccaccaccaccaccagtcacgcggggcctgtacctcccatgaccctcagagcagccgg
ggtagtcggaggaggaggcgacagcggtctgagaagaagaaagcccactaccggcagagc
agcttccctcattgctctgacctgatgcccagtggctctgaggagaagatcctgagggag
ctgagtgaggaggaggaagatgaggaggaggaggaagaggaggaagaggagggaaggttt
tactatagtgaagatgaccatggtgatgagtgttcctacacggatctgctgcctcaggat
gagggcggtggcggctacagttcagtccgctacagtgactgttgtgaacgtgtggtgata
aatgtgtcaggcctacgctttgagacccaaatgaaaactctggcccagtttccagagact
ttgttgggagaccctgaaaagaggactcagtactttgaccctttgcgcaatgagtatttt
tttgacaggaaccgccccagctttgatgccatcttgtattattatcaatcaggaggccgc
ctgaagaggccagtcaatgtcccctttgatatcttcactgaggaggtgaagttctatcag
ttgggggaggaggccctgttgaagtttcgggaggacgagggctttgtgagagaagaggaa
gacagggccctccccgagaatgaatttaaaaagcagatttggctcctctttgaatatcca
gagagctccagtcctgcaaggggcatagccattgtgtccgtcctggtcatcttaatctcc
attgtcatcttttgcctggaaaccttgcctgagtttagggacgacagggatctcgtcatg
gcactgagtgctggcgggcatggtgggttgttgaatgatacttcagcaccccatctggag
aactcagggcacacaatattcaatgaccccttcttcatcgtggaaacagtctgtattgta
tggttttcctttgagtttgtggttcgctgctttgcttgtcccagccaagcactcttcttc
aaaaacatcatgaacatcattgacattgtctccattttgccttacttcatcacactgggc
actgacctggcccagcaacaggggggtggcaatggtcagcagcagcaggccatgtccttt
gccatcctcagaatcattcgtctggtccgagtattccggatcttcaaactctccaggcac
tccaaaggcctgcagatcctgggccacaccctcagagccagcatgcgggaactgggcctt
ctgatcttcttcctcttcattggggtcatcctcttttctagtgctgtgtattttgcagag
gcggatgaacctactacccatttccaaagcatcccagatgcattttggtgggctgtggtg
accatgacaactgtgggctatggggacatgaagcccatcactgtagggggcaagattgtc
gggtccctgtgtgccattgcgggtgtcttaaccattgctttgccagtgccagtgattgtc
tctaactttaactatttctaccacagagagactgaaaatgaggaacagacacagctaacg
cagaatgcagtcagttgtccatacctcccctctaatttgctcaagaaatttcggagctct
acttcttcttccctgggggacaagtcagagtatctagagatggaagaaggagttaaggaa
tctctgtgtgcaaaggaggagaagtgtcagggaaagggggatgacagtgagacagataaa
aacaactgttctaatgcaaaggctgtggagactgatgtgtga

DBGET integrated database retrieval system