KEGG   Homo sapiens (human): 374291Help
Entry
374291            CDS       T01001                                 

Gene name
NDUFS7, CI-20, CI-20KD, MY017, PSST
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit S7
  KO
K03940  NADH dehydrogenase (ubiquinone) Fe-S protein 7 [EC:7.1.1.2 1.6.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Disease
H00473  Mitochondrial complex I deficiency
H01354  Leigh syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    374291 (NDUFS7)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    374291 (NDUFS7)
  09159 Environmental adaptation
   04714 Thermogenesis
    374291 (NDUFS7)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    374291 (NDUFS7)
   05012 Parkinson disease
    374291 (NDUFS7)
   05016 Huntington disease
    374291 (NDUFS7)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    374291 (NDUFS7)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     374291 (NDUFS7)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Hydron translocation or charge separation linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     374291 (NDUFS7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Oxidored_q6
Motif
Other DBs
NCBI-GeneID: 374291
NCBI-ProteinID: NP_077718
OMIM: 601825
HGNC: 7714
Ensembl: ENSG00000115286
Vega: OTTHUMG00000168077
Pharos: O75251(Tclin)
UniProt: O75251 Q7LD69
Structure
PDB: 

Position
19p13.3
AA seq 213 aa AA seqDB search
MAVLSAPGLRGFRILGLRSSVGPAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRG
EYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVM
IVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYI
PGCPPTAEALLYGILQLQRKIKRERRLQIWYRR
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgctgtcagctcctggcctgcgcggcttccggatccttggtctgcgctccagc
gtgggcccggctgtgcaggcacgaggtgtccatcagagcgtggccaccgatggcccaagc
agcacccagcctgccctgccaaaggccagagccgtggctcccaaacccagcagccggggc
gagtatgtggtggccaagctggatgacctcgtcaactgggcccgccggagttctctgtgg
cccatgaccttcggcctggcctgctgcgccgtggagatgatgcacatggcagcaccccgc
tacgacatggaccgctttggcgtggtcttccgcgccagcccgcgccagtccgacgtcatg
atcgtggccggcacactcaccaacaagatggccccagcgcttcgcaaggtctacgaccag
atgccggagccgcgctacgtggtctccatggggagctgcgccaacggaggaggctactac
cactattcctactcggtggtgaggggctgcgaccgcatcgtgcccgtggacatctacatc
ccaggctgcccacctacggccgaggccctgctctacggcatcctgcagctgcagaggaag
atcaagcgggagcggaggctgcagatctggtaccgcaggtag

DBGET integrated database retrieval system