KEGG   Homo sapiens (human): 374378Help
Entry
374378            CDS       T01001                                 

Gene name
GALNT18, GALNACT18, GALNT15, GALNTL4, GalNAc-T15, GalNAc-T18
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 18
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00512  Mucin type O-glycan biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    374378 (GALNT18)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    374378 (GALNT18)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     374378 (GALNT18)
Glycosyltransferases [BR:hsa01003]
 O-Glycan biosynthesis
  Mucin-type
   374378 (GALNT18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 374378
NCBI-ProteinID: NP_940918
OMIM: 615136
HGNC: 30488
Ensembl: ENSG00000110328
Vega: OTTHUMG00000165707
Pharos: Q6P9A2(Tdark)
UniProt: Q6P9A2 Q58A54
Position
11p15.4
AA seq 607 aa AA seqDB search
MVCTRKTKTLVSTCVILSGMTNIICLLYVGWVTNYIASVYVRGQEPAPDKKLEEDKGDTL
KIIERLDHLENVIKQHIQEAPAKPEEAEAEPFTDSSLFAHWGQELSPEGRRVALKQFQYY
GYNAYLSDRLPLDRPLPDLRPSGCRNLSFPDSLPEVSIVFIFVNEALSVLLRSIHSAMER
TPPHLLKEIILVDDNSSNEELKEKLTEYVDKVNSQKPGFIKVVRHSKQEGLIRSRVSGWR
AATAPVVALFDAHVEFNVGWAEPVLTRIKENRKRIISPSFDNIKYDNFEIEEYPLAAQGF
DWELWCRYLNPPKAWWKLENSTAPIRSPALIGCFIVDRQYFQEIGLLDEGMEVYGGENVE
LGIRVWQCGGSVEVLPCSRIAHIERAHKPYTEDLTAHVRRNALRVAEVWMDEFKSHVYMA
WNIPQEDSGIDIGDITARKALRKQLQCKTFRWYLVSVYPEMRMYSDIIAYGVLQNSLKTD
LCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHVGILSPTVDDDDNRCLVDVNSRPRL
IECSYAKAKRMKLHWQFSQGGPIQNRKSKRCLELQENSDLEFGFQLVLQKCSGQHWSITN
VLRSLAS
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgcaccaggaagaccaaaactttggtgtccacttgcgtgatcctgagcggcatg
actaacatcatctgcctgctctacgtgggctgggtcaccaactacatcgccagcgtgtat
gtgcgggggcaggagccggcgcccgacaagaagctggaggaagacaaaggggacactctg
aagattattgagcggctggaccacctggagaatgtcatcaagcagcacattcaagaggct
cctgccaagcctgaggaggcagaggccgagcccttcacagactcctctctgtttgcacac
tggggccaggagctcagccccgaaggccggcgcgtggccctgaagcaattccagtactac
ggctacaacgcctacctcagcgaccgcctgcccctggaccggcccctgcctgacctcaga
cccagtgggtgccgtaacctctcatttcctgacagcctgccagaggtgagcatcgtgttc
atcttcgtcaatgaagcgctttcagtgctgctgcgctccatccactcggccatggaacgc
acgcccccacatctgctcaaggagatcattctggtggatgacaacagcagtaacgaggaa
ctgaaggagaagctgaccgaatatgtggacaaggtgaacagccagaagccaggcttcatc
aaagtcgtgcgtcacagcaagcaggaaggcctcatccgctccagggtcagtggctggagg
gcggccactgcccctgtggtggcactctttgatgcccacgtggagttcaatgtgggctgg
gctgaacctgtactcacccgcatcaaggagaaccggaagcggatcatctcgccatccttt
gataacatcaaatatgacaactttgagatagaagagtacccgctggctgcccagggcttt
gactgggagctgtggtgccgctacctaaatccccccaaggcctggtggaagctggagaac
tccacagcgccaatcaggagccctgccctcattggctgcttcattgtggaccggcagtac
ttccaggagatcggcctgctggacgaaggcatggaagtctacgggggcgagaatgtggag
cttgggatcagggtgtggcagtgtggcgggagtgtggaggtcctgccctgctcacggatt
gcccacattgagcgagcccacaagccctacacagaggacctcaccgcccatgtccgcagg
aacgctctcagggtggctgaagtctggatggatgaatttaaaagccacgtctacatggca
tggaacataccgcaggaggactcaggaattgacattggggacatcactgcaaggaaggct
ctcaggaaacagctgcagtgcaagaccttccggtggtacctggtcagcgtgtacccagag
atgaggatgtactccgacatcattgcctatggagtgctgcagaattctctgaagactgat
ttgtgtcttgaccaggggccagatacagagaatgtccccatcatgtacatctgccatggg
atgacgcctcagaacgtgtactacacgagcagtcagcagatccatgtgggcattctgagc
cccaccgtggatgatgatgacaaccgatgcctggtggacgtcaacagccggccccggctc
atcgaatgcagctacgccaaagccaagaggatgaagcttcactggcagttctctcaggga
ggacccatccagaaccgcaagtctaagcgctgtctggagctgcaggagaatagcgacctg
gagttcggcttccagctggtgttgcagaagtgctcgggccagcactggagcatcaccaac
gtcctgaggagcctcgcgtcctga

DBGET integrated database retrieval system