KEGG   Homo sapiens (human): 374395Help
Entry
374395            CDS       T01001                                 

Gene name
TMEM179B
Definition
(RefSeq) transmembrane protein 179B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TMEM117 Ycf70 Herpes_LMP1
Motif
Other DBs
NCBI-GeneID: 374395
NCBI-ProteinID: NP_955369
HGNC: 33744
Ensembl: ENSG00000185475
Vega: OTTHUMG00000167611
Pharos: Q7Z7N9(Tdark)
UniProt: Q7Z7N9
Position
11q12.3
AA seq 219 aa AA seqDB search
MALSWLQRVELALFAAAFLCGAVAAAAMTRTQGSFSGRCPLYGVATLNGSSLALSRPSAP
SLCYFVAGASGLLALYCLLLLLFWIYSSCIEDSHRGAIGLRIALAISAIAVFLVLVSACI
LRFGTRSLCNSIISLNTTISCSEAQKIPWTPPGTALQFYSNLHNAETSSWVNLVLWCVVL
VLQVVQWKSEATPYRPLERGDPEWSSETDALVGSRLSHS
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgtcctggctgcagcgcgtcgagcttgcgctctttgctgccgccttcctgtgc
ggggccgtggcggccgcggcgatgactcggacccagggctccttcagtggtagatgtccc
ctgtatggtgtggccaccctgaatggctcctccctggccttatcccgtccctcagcacca
tccctgtgctactttgtagctggggcctctggcctcttggccctctactgcctcctgctt
ttgctcttctggatctacagcagctgcatcgaggactcccacagaggtgctatagggctg
cgcattgcactggccatctcagctatagccgtcttcctggtcttggtgtctgcctgtatc
cttcgatttggcaccaggtctctctgcaactccatcatctccttgaacactacaattagc
tgttctgaagcccagaaaattccatggacaccccctggaactgctctgcagttttactcc
aacctacacaatgctgaaacctcttcttgggtgaatttggtattgtggtgtgtggtcttg
gtgctccaggtcgtgcagtggaagtctgaagccaccccataccggcctctggagaggggt
gaccctgagtggagctctgagacagatgctctcgttgggtcacgcctttcccattcctga

DBGET integrated database retrieval system