KEGG   Homo sapiens (human): 374454Help
Entry
374454            CDS       T01001                                 

Gene name
KRT77, K1B, KRT1B
Definition
(RefSeq) keratin 77
  KO
K07605  type II keratin, basic
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    374454 (KRT77)
   04147 Exosome [BR:hsa04147]
    374454 (KRT77)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     374454 (KRT77)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   374454 (KRT77)
  Exosomal proteins of other body fluids (saliva and urine)
   374454 (KRT77)
  Exosomal proteins of colorectal cancer cells
   374454 (KRT77)
  Exosomal proteins of bladder cancer cells
   374454 (KRT77)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament Keratin_2_head AAA_13 CHDCT2 ADIP FlgN CENP-F_leu_zip Golgin_A5 Taxilin Alanine_zipper SAT WEMBL LOB XhlA ApoO Spc7
Motif
Other DBs
NCBI-GeneID: 374454
NCBI-ProteinID: NP_778253
OMIM: 611158
HGNC: 20411
Ensembl: ENSG00000189182
Vega: OTTHUMG00000169450
Pharos: Q7Z794(Tdark)
UniProt: Q7Z794 Q0IIN1
Position
12q13.13
AA seq 578 aa AA seqDB search
MSHQFSSQSAFSSMSRRVYSTSSSAGSGGGSPAVGSVCYARGRCGGGGYGIHGRGFGSRS
LYNLGGSRSISINLMGRSTSGFCQGGGVGGFGGGRGFGVGSTGAGGFGGGGFGGAGFGTS
NFGLGGFGPYCPPGGIQEVTINQSLLEPLHLEVDPEIQRIKTQEREQIMVLNNKFASFID
KVRFLEQQNQVLQTKWELLQQVNTSTGTNNLEPLLENYIGDLRRQVDLLSAEQMRQNAEV
RSMQDVVEDYKSKYEDEINKRTGSENDFVVLKKDVDAAYVSKVDLESRVDTLTGEVNFLK
YLFLTELSQVQTHISDTNVILSMDNNRSLDLDSIIDAVRTQYELIAQRSKDEAEALYQTK
YQELQITAGRHGDDLKNSKMEIAELNRTVQRLQAEISNVKKQIEQMQSLISDAEERGEQA
LQDAWQKLQDLEEALQQSKEELARLLRDYQAMLGVKLSLDVEIATYRQLLEGEESRMSGE
LQSHVSISVQNSQVSVNGGAGGGGSYGSGGYGGGSGGGYGGGRSYRGGGARGRSGGGYGS
GCGGGGGSYGGSGRSGRGSSRVQIIQTSTNTSHRRILE
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgagccaccaatttagttctcagtccgcgtttagttcaatgagcaggcgggtttatagt
accagctcttctgcaggctctggtggtgggagtccggcagtgggttctgtgtgttatgct
cgagggaggtgtggtggtggtggatatgggatccatggaagggggtttggctctaggagc
ctctacaatctgggtggcagtagaagcatctccattaatctaatggggaggagcaccagt
ggtttctgccagggtgggggagtagggggatttggagggggcagaggctttggggttggc
agcaccggggctggtggctttggaggaggtggttttgggggtgctggatttgggactagc
aattttgggcttgggggctttggtccttattgtcctcctgggggcatccaagaggtgacc
attaaccagagcctcctagagccacttcacctggaggtggaccctgaaattcagaggatc
aagacccaggagcgggagcagattatggttctcaacaacaagtttgcctccttcattgac
aaggtgcgattcctggagcagcagaaccaggtgctacaaacaaaatgggagttgctgcag
caggtgaacacctcaactggaaccaacaacctggagcccctcttggagaactacatcggt
gacctgcggaggcaggtggatttgctcagtgcggagcagatgcgccagaacgcggaggtc
aggagcatgcaggatgtcgtggaggactacaagagcaagtatgaggatgaaatcaacaag
aggactggcagcgagaatgactttgtcgtcctgaagaaggatgtggatgctgcttatgtg
agcaaagtggacctggagtccagggtggacactctgactggggaggtcaatttcttgaaa
tatttatttttgacggagctgtctcaggtgcagactcacatcagcgacaccaacgtcatc
ctgtccatggacaataaccgttccctggacctggacagcatcatcgatgcagtgcggacc
cagtatgaactgattgcacagaggagcaaggacgaggccgaagccctgtaccagaccaag
taccaggagctccagatcacggcagggagacatggagacgacctgaagaacagcaagatg
gagattgcagagctcaaccgcaccgtccagaggctgcaggcagagatcagcaacgtgaag
aagcagattgaacagatgcagtcactcatttcggatgctgaggagagaggcgagcaggcc
ctccaggatgcgtggcagaagctgcaggacctggaggaggccctgcagcagtccaaggag
gagctggcccggctgctgcgtgactaccaggccatgctgggggtcaagctgtccctggat
gtggagatcgccacctaccgccagctgctggagggcgaggagagcaggatgtcaggagag
ctgcagagccatgtgagcatctccgtgcagaacagccaggtgagcgtcaacggcggcgcg
ggaggcggcggcagctacggctcaggaggctacggcggcggcagcggtgggggctatggc
ggcggaagaagctaccgcggaggcggggcacgaggcaggagtggaggcggttatggcagc
ggctgcggcggcggtggcgggagctacggagggagcggcagaagcggccgcggatcctcg
cgcgtgcagatcatccagacctccaccaacacctcccacaggcggatcttggagtag

DBGET integrated database retrieval system