KEGG   Homo sapiens (human): 374569
Entry
374569            CDS       T01001                                 

Symbol
ASPG, C14orf76, GPA/WT, LYSOLP
Name
(RefSeq) asparaginase
  KO
K13278  60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    374569 (ASPG)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     374569 (ASPG)
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     374569 (ASPG)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     374569 (ASPG)
SSDB
Motif
Pfam: Asparaginase Asparaginase_C Ank_2 Ank_4 Ank Ank_5 Ank_3
Other DBs
NCBI-GeneID: 374569
NCBI-ProteinID: NP_001073933
OMIM: 618472
HGNC: 20123
Ensembl: ENSG00000166183
Vega: OTTHUMG00000170045
Pharos: Q86U10(Tbio)
UniProt: Q86U10
Position
14q32.33
AA seq 573 aa
MARAVGPERRLLAVYTGGTIGMRSELGVLVPGTGLAAILRTLPMFHDEEHARARGLSEDT
LVLPPASRNQRILYTVLECQPLFDSSDMTIAEWVCLAQTIKRHYEQYHGFVVIHGTDTMA
FAASMLSFMLENLQKTVILTGAQVPIHALWSDGRENLLGALLMAGQYVIPEVCLFFQNQL
FRGNRATKVDARRFAAFCSPNLLPLATVGADITINRELVRKVDGKAGLVVHSSMEQDVGL
LRLYPGIPAALVRAFLQPPLKGVVMETFGSGNGPTKPDLLQELRVATERGLVIVNCTHCL
QGAVTTDYAAGMAMAGAGVISGFDMTSEAALAKLSYVLGQPGLSLDVRKELLTKDLRGEM
TPPSVEERRPSLQGNTLGGGVSWLLSLSGSQEADALRNALVPSLACAAAHAGDVEALQAL
VELGSDLGLVDFNGQTPLHAAARGGHTEAVTMLLQRGVDVNTRDTDGFSPLLLAVRGRHP
GVIGLLREAGASLSTQELEEAGTELCRLAYRADLEGLQVWWQAGADLGQPGYDGHSALHV
AEAAGNLAVVAFLQSLEGAVGAQAPCPEVLPGV
NT seq 1722 nt   +upstreamnt  +downstreamnt
atggcgcgcgcggtggggcccgagcggaggctgctggccgtctacaccggcggcaccatt
ggcatgcggagtgagctcggcgtgcttgtgcccgggacgggcctggctgccatcctgagg
acactgcccatgttccatgacgaggagcacgcccgagcccgcggcctctctgaggacacc
ctggtgctacccccggccagccgcaaccagaggattctctacaccgtgctggagtgccag
cccctcttcgactccagtgacatgaccatcgctgagtgggtttgccttgcccagaccatc
aagaggcactacgagcagtaccacggctttgtggtcatccacggcaccgacaccatggcc
tttgctgcctcgatgctgtccttcatgctggagaacctgcagaagactgtcatcctcact
ggggcccaggtgcccatccatgccctgtggagcgacggccgtgagaacctgctgggggca
ctgctcatggctggccagtatgtgatcccagaggtctgccttttcttccagaatcagctg
tttcggggcaaccgggcaaccaaggtagacgctcggaggttcgcagctttctgctccccg
aacctgctgcctctggccacagtgggtgctgacatcacaatcaacagggagctggtgcgg
aaggtggacgggaaggctgggctggtggtgcacagcagcatggagcaggacgtgggcctg
ctgcgcctctaccctgggatccctgccgccctggttcgggccttcttgcagcctcccctg
aagggcgtggtcatggagaccttcggttcagggaacggacccaccaagcccgacctgctg
caggagctgcgggtggccaccgagcgcggcctggtcatcgtcaactgtacccactgcctc
cagggggctgtgaccacagactatgcagctggcatggccatggcgggagccggcgtcatc
tcaggcttcgacatgacatcggaggccgccctggccaagctatcgtatgtgctgggccag
ccagggctgagcctggatgtcaggaaggagctgctgaccaaggaccttcggggggagatg
acgccaccctcggtggaagagcgccggccctcactgcagggcaacacgctgggcggtggg
gtctcctggctcctcagtctgagcggcagccaggaggcagatgccctgcggaatgccctg
gtgcccagcctggcctgtgctgctgcccacgccggtgacgtggaggcgctgcaggcgctt
gtggagctgggcagtgacctgggcctggtggactttaacggccaaaccccactgcacgcg
gccgcccggggaggccacacagaggcagtcaccatgctgctgcagagaggtgtggacgtg
aacacccgggacacggatggcttcagcccgctgctgctggccgtgcggggcaggcatccg
ggtgtcattgggttgctgcgggaagccggggcctccctgtccacccaggagctggaggaa
gcagggacggagctgtgcaggctggcatacagggccgacctcgaaggcctgcaggtgtgg
tggcaggcaggggctgacctggggcagccgggctatgacgggcacagcgccctgcacgtc
gcagaggcagccgggaacctggcagtggtggcctttctacagagcctggagggtgcggtt
ggtgcccaggccccatgcccagaagtgctgcctggtgtctaa

DBGET integrated database retrieval system