KEGG   Homo sapiens (human): 3747Help
Entry
3747              CDS       T01001                                 

Gene name
KCNC2, KV3.2
Definition
(RefSeq) potassium voltage-gated channel subfamily C member 2
  KO
K04888  potassium voltage-gated channel Shaw-related subfamily C member 2
Organism
hsa  Homo sapiens (human)
Drug target
Amifampridine: D10228 D10689
Fampridine: D04127
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3747 (KCNC2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   3747 (KCNC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 BTB_3
Motif
Other DBs
NCBI-GeneID: 3747
NCBI-ProteinID: NP_631875
OMIM: 176256
HGNC: 6234
Ensembl: ENSG00000166006
Vega: OTTHUMG00000169717
Pharos: Q96PR1(Tclin)
UniProt: Q96PR1 A0A024RBA5
Position
12q21.1
AA seq 638 aa AA seqDB search
MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPP
LSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRT
GKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPG
DDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFIL
VSITTFCLETHEAFNIVKNKTEPVINGTSVVLQYEIETDPALTYVEGVCVVWFTFEFLVR
IVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFK
LTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQ
FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYY
SLAMAKQKLPRKRKKHIPPAPQASSPTFCKTELNMACNSTQSDTCLGKDNRLLEHNRSVL
SGDDSTGSEPPLSPPERLPIRRSSTRDKNRRGETCFLLTTGDYTCASDGGIRKGYEKSRS
LNNIAGLAGNALRLSPVTSPYNSPCPLRRSRSPIPSIL
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcgagaacaacgagagggtgatcctcaatgtcgggggcacccggcacgaa
acctaccgcagcaccctcaagaccctgcctggaacacgcctggcccttcttgcctcctcc
gagcccccaggcgactgcttgaccacggcgggcgacaagctgcagccgtcgccgcctcca
ctgtcgccgccgccgagagcgcccccgctgtcccccgggccaggcggctgcttcgagggc
ggcgcgggcaactgcagttcccgcggcggcagggccagcgaccatcccggtggcggccgc
gagttcttcttcgaccggcacccgggcgtcttcgcctatgtgctcaattactaccgcacc
ggcaagctgcactgccccgcagacgtgtgcgggccgctcttcgaggaggagctggccttc
tggggcatcgacgagaccgacgtggagccctgctgctggatgacctaccggcagcaccgc
gacgccgaggaggcgctggacatcttcgagacccccgacctcattggcggcgaccccggc
gacgacgaggacctggcggccaagaggctgggcatcgaggacgcggcggggctcgggggc
cccgacggcaaatctggccgctggaggaggctgcagccccgcatgtgggccctcttcgaa
gacccctactcgtccagagccgccaggtttattgcttttgcttctttattcttcatcctg
gtttcaattacaactttttgcctggaaacacatgaagctttcaatattgttaaaaacaag
acagaaccagtcatcaatggcacaagtgttgttctacagtatgaaattgaaacggatcct
gccttgacgtatgtagaaggagtgtgtgtggtgtggtttacttttgaatttttagtccgt
attgttttttcacccaataaacttgaattcatcaaaaatctcttgaatatcattgacttt
gtggccatcctacctttctacttagaggtgggactcagtgggctgtcatccaaagctgct
aaagatgtgcttggcttcctcagggtggtaaggtttgtgaggatcctgagaattttcaag
ctcacccgccattttgtaggtctgagggtgcttggacatactcttcgagctagtactaat
gaatttttgctgctgataattttcctggctctaggagttttgatatttgctaccatgatc
tactatgccgagagagtgggagctcaacctaacgacccttcagctagtgagcacacacag
ttcaaaaacattcccattgggttctggtgggctgtagtgaccatgactaccctgggttat
ggggatatgtacccccaaacatggtcaggcatgctggtgggagccctgtgtgctctggct
ggagtgctgacaatagccatgccagtgcctgtcattgtcaataattttggaatgtactac
tccttggcaatggcaaagcagaaacttccaaggaaaagaaagaagcacatccctcctgct
cctcaggcaagctcacctactttttgcaagacagaattaaatatggcctgcaatagtaca
cagagtgacacatgtctgggcaaagacaatcgacttctggaacataacagatcagtgtta
tcaggtgacgacagtacaggaagtgagccgccactatcacccccagaaaggctccccatc
agacgctctagtaccagagacaaaaacagaagaggggaaacatgtttcctactgacgaca
ggtgattacacgtgtgcttctgatggagggatcaggaaaggatatgaaaaatcccgaagc
ttaaacaacatagcgggcttggcaggcaatgctctgaggctctctccagtaacatcaccc
tacaactctccttgtcctctgaggcgctctcgatctcccatcccatctatcttgtaa

DBGET integrated database retrieval system